You Searched For: Molecular+Bioproducts+Inc.


377,326  results were found

SearchResultCount:"377326"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (103003-158)
Supplier: Anaspec Inc
Description: Rat adrenomedullin, rADM, (1-50) and its C-terminal rADM (11-50) induce a dose-dependent and endothelium-independent vasodilation on the arterial mesenteric vasculature.
Sequence:YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Disulfide bridge: 14-19)
MW:5729.5 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C


Supplier: ACROBIOSYSTEMS
Description: Cynomolgus CD3 epsilon/CD3 delta Protein, His Tag/Flag Tag, Host: HEK293 cells, Species Reactivity: Cynomolgus, purity: >92% SDS-PAGE, Molecular Characterization: MW of 15.5 kDa, Synonym: CD3 delta/epsilon, size: 100ug

Catalog Number: (103011-370)
Supplier: Anaspec Inc
Description: Used for measuring membrane potential of mitochondria; Fluorescence is less dependent on dye location.


Supplier: ACROBIOSYSTEMS
Description: Avitag* Biotinylated Human CD47 Fc Tag Avi Tag, Host: HEK293 cells, Species Reactivity: Human, purity: >95% SDS-PAGE, Molecular Characterization: MW of 42.2 kDa, Synonym: CD47,MER6,IAP,OA3, Storage: 4 Degree C, size: 200ug

Catalog Number: (103006-974)
Supplier: Anaspec Inc
Description: This is a peptide fragment (979-989) of the insulin receptor substrate-1 containing the sequence motif YMXM known to bind to the two domains of SH2 on the 85kDa subunit of phosphoinositide 3-kinase.
Sequence:KKSRGDYMTMQIG-NH2
MW:1513.8 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103008-180)
Supplier: Anaspec Inc
Description: This peptide is derived from Histone H3 21-44 amino acids, and is usually used as a substrate for methylation assays. It has been used as a substrate for protein arginine methyltransferases
Sequence:ATKAARKSAPATGGVKKPHRYRPG
MW:2505.9 Da
% peak area by HPLC:95
Storage condition:-20° C


Supplier: ACROBIOSYSTEMS
Description: SLAMF7/CRACC/CD319 Protein, Fc Tag, Host: HEK293, Species Reactivity: Human, Purity: >95% by SDS-PAGE, Molecular Characterization: fused with a human IgG1 Fc tag at C-terminus, MW of 49 kDa, Synonym: SLAMF7, CD319, Storage: 4 deg C, Size: 100ug

Supplier: ACROBIOSYSTEMS
Description: TRAIL R2/DR5/TNFRSF10B Protein, Fc Tag, Host: HEK293 cells, Species Reactivity: Human, Purity: >95% (SDS-PAGE), Molecular Characterization: Fc Tag fused with IgG1 Fc tag at C-terminus, MW 40.5KDa, Synonyms: TNFRSF10B,TRAILR2, Size: 1mg

Catalog Number: (102998-700)
Supplier: Anaspec Inc
Description: Multiple Antigenic Peptides (MAPs) are synthetic peptides with 4 branches harboring 2 Lysines each. The Lys residues are used as a scaffold to support 8 peptides. MAPs are used to increase the mass of the peptide entity when used as antigen in immunizations. They represent an alternative to carrier proteins, such as BSA or KLH.
Sequence:K4K2KA - NH2
MW:985.3 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103014-918)
Supplier: ACROBIOSYSTEMS
Description: ActiveMax* Recombinant LIF, Host: HEK293 Cells, Species Reactivity: Human, purity: >95%, Molecular Characterization: Gly-Pro at the N- terminus, MW of 19.9 kDa, Endotoxin: Less than 1.0 EU per ug, Synonym: LIF,CDF,DIA,HILDA,MLPLI, Storage: 4 deg C, Size: 50UG


Supplier: ACROBIOSYSTEMS
Description: TFPI Protein, Host: HEK293, Species Reactivity: Human, Purity: >90% by SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at the C-terminus, calculated MW of 30 kDa, Endotoxin: < 1.0 EU per ug, Synonym: TFPI,LACI,TFPI1,EPI,TFI, Storage: 4 deg C, Size: 50ug

Catalog Number: (103007-276)
Supplier: Anaspec Inc
Description: This peptide is a fragment of the influenza virus matrix protein amino acid residues 62 to 70. It contains the core sequence of a new major histocompatibility complex class II-restricted T-cell epitope of influenza virus matrix protein. This epitope was detected in the peripheral blood of influenza A patients.
Sequence:GFVFTLTVPSER
MW:1352.6 Da
% peak area by HPLC:95
Storage condition:-20° C


Supplier: ACROBIOSYSTEMS
Description: Mouse 4-1BB Ligand/TNFSF9 Protein, Fc Tag, Host: HEK293 cells, Species Reactivity: mouse, purity: >95% SDS-PAGE, Molecular Characterization: fused with a human IgG1 Fc tag at the C-terminus, MW of 49 kDa, Synonym: 4-1BB Ligand, TNFSF9, size: 1mg

Supplier: ACROBIOSYSTEMS
Description: PROCR/EPCR/CD201 Protein, Fc Tag, Host: HEK293, Species Reactivity: Human, Purity: >95% by SDS-PAGE, Molecular Characterization: fused with Fc fragment of human IgG1 at C-terminus, MW of 48.6 kDa, Synonym: PROCR, EPCR, CD201, Storage: 4 deg C, Size: 1mg

Supplier: ACROBIOSYSTEMS
Description: VEGF R2/KDR Protein, Host: HEK293 cells, Species Reactivity: Rhesus macaque, Purity: >97% (SDS-PAGE), Molecular Characterization: His Tag fused with polyhistidine tag at C-terminus, MW 85.2KDa, Synonyms: KDR,CD309,FLK1,VEGFR, Storage: 4 deg C, Size: 100ug

Catalog Number: (103002-742)
Supplier: Anaspec Inc
Description: The NGR (Asn-Gly-Arg) peptide motif is an aminopeptidase N (CD13) ligand that targets angiogenic blood vessels. NGR-containing peptides have been proven useful for delivering cytotoxic drugs, proapoptotic peptides and tumor necrosis factor (TNF) to tumor vasculature.
Sequence:CNGRCG (Disulfide bridge: 1-5)
MW:606.7 Da
% peak area by HPLC:95
Storage condition:-20° C


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,361 - 1,376 of 377,326
no targeter for Bottom