Print…

You Searched For: Molecular+Bioproducts+Inc.


377,326  results were found

Refine Results Sort by
SearchResultCount:"377326"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-75842-138

Anti-CD19 Rat Monoclonal Antibody (PE (Phycoerythrin)) [clone: 1D3]

Catalog Number: (75842-138)
Supplier: BIOGEMS INTERNATIONAL INC.
Description: The 1D3 monoclonal antibody specifically reacts with mouse CD19, a 95 kDa transmembrane glycoprotein, a member of the Ig superfamily and a B cell-lineage differentiation antigen expressed by all the B lymphocyte development stages, except for the terminally differentiated plasma cells. CD19 associates with CD21, CD81 and MHC class II to form a multi-molecular complex that initiates the mature B lymphocyte activation by interaction with the B-cell receptors. CD 19 enhances the B cell proliferation, development and activation, and the maturation of memory B cells. In CD19-deficient mice, the generation and maturation of B lymphocytes in the bone marrow and periphery are affected.
Image Unavailable-102996-882

PKC (Protein Kinase C) Substrate

Catalog Number: (102996-882)
Supplier: Anaspec Inc
Description: The peptide sequence, ERMRPRKRQGSVRRRV (cat# 27183-1), corresponds to pseudosubstrate region of the ε-isotype of protein kinase C (PKCε) with an alanine to serine substitution. PKCε exhibits an apparent specificity for the native peptide (Km = 68 µM).
Sequence:ERMRPRKRQGSVRRRV
MW:2067.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-102996-096

Pig Big Endothelin 1 (1-39)

Catalog Number: (102996-096)
Supplier: Anaspec Inc
Description: This is a 38 residue inactive big endothelin-1 intermediate that gives rise to a shorter active peptide produced in vascular endothelial cells.
Sequence:CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS (Disulfide bridge: 1-15 and 3-11)
MW:4384.1 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103008-232

Interphotoreceptor Retinoid Binding Protein Fragment Peptide

Catalog Number: (103008-232)
Supplier: Anaspec Inc
Description: R16 is an IRBP (Interphotoreceptor retinoid binding protein) derived peptide. Photoreceptor cell protein is capable of inducing an experimental autoimmune uveitis (EAU) in susceptible animal strains.
Sequence:ADGSSWEGVGVVPDV
MW:1473.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103815-462

Mouse Recombinant Fc gamma RIIB/ CD32b (from HEK293 Cells)

Catalog Number: (103815-462)
Supplier: ACROBIOSYSTEMS
Description: Mouse Fc gamma RIIB / CD32b Protein, His Tag (SPR & BLI verified), ACROBiosystems
Image Unavailable-103005-902

Crosstide

Catalog Number: (103005-902)
Supplier: Anaspec Inc
Description: Crosstide is a peptide analog of glycogen synthase kinase-3 (GSK-3) that functions as a natural substrate for Akt/PKB. It displays similar specificities towards PKBα, PKBβ and PKBγ isoforms. It is also recognized by MAPKAP kinase-1 and p70S6K. The fluorescent and biotinlyated peptides demonstrate similar enzyme activities.
Sequence:GRPRTSSFAEG
MW:1164.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103008-020

[Lys(Me3)4]-Histone H3 (1-10)

Catalog Number: (103008-020)
Supplier: Anaspec Inc
Description: This peptide is Histone H3 amino acid residues 1 to 10 tri-methylated at Lys-4.
Sequence:ART-K(Me3)-QTARKS
MW:1188.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103003-278

Influenza A NP(366-374) Strain A/PR/8/35

Catalog Number: (103003-278)
Supplier: Anaspec Inc
Description: This peptide is an H2-Db-restricted epitope from the Influenza A/PR/8/34 nucleoprotein.
Sequence:ASNENMETM
MW:1027.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103003-696

Human;Pig;Rat Viasoactive intestinal peptide (1-12)

Catalog Number: (103003-696)
Supplier: Anaspec Inc
Description: VIP (1−12), vasoactive intestinal peptide fragment 1-12 with a mass of 1425.5 da, is mostly used as a standard in mass spectrometry
Sequence:HSDAVFTDNYTR
MW:1425.5 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103790-346

Mouse Recombinant Fc gamma RIV/ CD16-2 (from HEK293 Cells)

Supplier: ACROBIOSYSTEMS
Description: Mouse Fc gamma RIV / CD16-2 Protein, His Tag, ACROBiosystems

Image Unavailable-103815-520

Mouse Recombinant Fc gamma RIII/ CD16 (from HEK293 Cells)

Catalog Number: (103815-520)
Supplier: ACROBIOSYSTEMS
Description: Mouse Fc gamma RIII / CD16 Protein, His Tag (SPR & BLI verified), ACROBiosystems
Image Unavailable-103007-830

Bcl-2 Binding Peptide

Catalog Number: (103007-830)
Supplier: Anaspec Inc
Description: This is a bcl-2 binding peptide. This peptide is derived from the BH3 domain (a death domain) of Bad, amino acid residues 140 to 165.
Sequence:LWAAQRYGRELRRMSDEFEGSFKGL
MW:3003.4 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-10774-376

Mouse Recombinant Adiponectin (from Hi-5 Insect cells)

Supplier: PeproTech, Inc.
Description: Adiponectin is an adipose-derived secreted protein containing 236 amino acid residues. It is relatively abundant in humans and rodents, accounting for about 0.01% of total plasma protein. The circulating levels of adiponectin are decreased under conditions of obesity, insulin resistance, and type II diabetes. Disruption of adiponectin in mice causes insulin resistance and neointimal formation. Conversely, administration of recombinant adiponectin suppresses hepatic glucose production, and reverses insulin resistance associated with both lipoatrophy and obesity. The protective role of adiponectin is attributed to its anti-inflammatory properties (e.g. ability to suppress expression of TNF-α and class A scavenger receptor in macrophages). Recombinant Human Adiponectin is a multimeric glycoprotein containing amino acids Val-21 to Asn-247 of the adiponectin precursor protein fused to an N-terminal histidine tag. Monomeric glycosylated adiponectin migrates at an apparent molecular weight of approximately 35.0 kDa by SDS PAGE analysis under reducing conditions. The calculated molecular weight of Recombinant Murine Adiponectin is 25.8 kDa.

Image Unavailable-103815-378

Mouse Recombinant Complement C5 (from HEK293 cells)

Supplier: ACROBIOSYSTEMS
Description: Mouse Complement C5 Protein, His Tag, ACROBiosystems

Image Unavailable-103006-350

Cyclo (-GRGDSP) Peptide

Supplier: Anaspec Inc
Description: This cyclic peptide is a potent vasodilator. It is more powerful than the linear GRGDSP in changing the vascular tone of arterioles isolated from rat cremaster muscle.
Sequence:GRGDSP, N to C cyclized
MW:569.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Image Unavailable-103815-522

Human Recombinant Fc gamma RIIIB/ CD16b (NA1) (from HEK293 cells)

Catalog Number: (103815-522)
Supplier: ACROBIOSYSTEMS
Description: Human Fc gamma RIIIB / CD16b (NA1) Protein, His Tag (SPR & BLI verified), ACROBiosystems
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,329 - 1,344 of 377,326
no targeter for Bottom