You Searched For: Molecular+Bioproducts+Inc.

Catalog Number: (53515-916)

Supplier: Thermo Fisher Scientific

Description: Finntip stepper tips are the perfect fit with Thermo Scientific Finnpipette stepper pipetters.

Certificates Sale

Supplier: Anaspec Inc

Description: Exendin-4 (Exenatide), an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.
Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
MW: 4186.6 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: PeproTech, Inc.

Description: Slit2 is a member of the Slit family that signals through the Roundabout (Robo) receptor as a repellent for axon guidance and neuronal migration, and also acts as a chemoattractant to vascular endothelial cells and a chemotaxis inhibitor for leukocytes. Slit2 is expressed primarily in the fetal lung, kidney, and adult spinal cord, and to a lesser extent in the adult adrenal gland, thyroid and trachea. Slit2 is initially synthesized as a 1499 amino acid precursor, which is subsequently cleaved into N-terminal and C-terminal fragments, designated as Slit2-N and Slit2-C respectively. The neurodevelopment-related activities, as measured by the ability to repel olfactory bulb axons and to induce branching in dorsal root ganglia axons, are contained only in the N-terminal fragment. Recombinant Human Slit2-N is a 1093 amino acid glycoprotein corresponding to the N-terminal portion of the full length Slit2 precursor, and has a calculated, theoretical molecular weight of 122.35 kDa. Due to glycosylation Slit2-N migrates at an apparent molecular weight of approximately 120.0-140.0 kDa by SDS-PAGE analysis under reducing conditions.

Catalog Number: (103006-594)

Supplier: Anaspec Inc

Description: This peptide is amino acids 17 to 26 fragment of p53, the Mdm-2 binding domain of p53 known also as p53N. This sequence contains all of the residues that contact the binding domain of Mdm-2. The tumor suppressor protein p53 is important in maintaining genome stability and in preventing cancer development.
Sequence:ETFSDLWKLL
MW:1251.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: ACROBIOSYSTEMS

Description: Biotinylated Fc gamma RIIA/CD32a (H131), Avitag*, Host: HEK293 cells, Species Reactivity: Human, Purity: >95% (SDS-PAGE), Molecular Characterization: Carries Avitag* at C-terminus, MW 24KDa, Synonyms: CD32a,FCGR2A,CD32, Storage: 4-8 deg C, Size: 200ug

Supplier: ACROBIOSYSTEMS

Description: CD14 Protein, Fc Tag, Host: HEK293 cells, Species Reactivity: Human, Purity: >97% (SDS-PAGE), Molecular Characterization: Fc Tag is fused with a human IgG1 Fc tag at the C-terminus, with calculated MW of of 62.4 KDa, Synonyms: CD14, Storage: 4 deg C, Size: 100ug

Supplier: ACROBIOSYSTEMS

Description: IL-4 R alpha/CD124 Protein, Fc Tag, Host: HEK293 Cells, Species reactivity: Cynomolgus, Purity: >95% SDS-PAGE, Molecular Characterization: Fc Tag is Fused with a human IgG1 Fc tag at the C-terminus, MW of 50.4 kDa, Synonym: IL4R, Size: 1mg

Supplier: ACROBIOSYSTEMS

Description: Human Semaphorin 4D/SEMA4D/CD100 Protein, Host: HEK293 cells, species reactivity: human, Purity: >95% SDS-PAGE, Molecular Characterization: Fc Tag is fused with a human IgG1 Fc tag at the C-terminus, MW of 105.4 kDa, Synonym: SEMA4D, Size: 100ug

Supplier: ACROBIOSYSTEMS

Description: Fc epsilon RI alpha Protein, Host: HEK293 Cells, Species: Human, Purity: >90% SDS-PAGE, Molecular Characterization: His Tag is fused with a polyhistidine tag at C-terminus, MW 21.9 kDa, Synonym: FCER1A, FCE1A, FcERI, Storage: at 4 deg C, Size: 100ug

Catalog Number: (103014-488)

Supplier: ACROBIOSYSTEMS

Description: IFN-alpha / beta R2 Protein, Fc Tag, Host: HEK293 Cells, Species Reactivity: Human, purity: >95%, Molecular Characterization: MW of 51.4 kDa, Synonym: IFNAR2,IFNARB,IFNABR,IFN-R-2,IFN-alpha/beta receptor 2, Storage: 4 deg C, Size: 1MG

Sale

Catalog Number: (103014-672)

Supplier: ACROBIOSYSTEMS

Description: IL-29 / IFN-lambda 1 Protein, Host: HEK293 Cells, Species Reactivity: Human, purity: >95%, Molecular Characterization: polyhistidine tag at the C-terminus, MW of 21.1 kDa, Synonym: IL29,IFNL1,IFN lambda 1,Interleukin-29,IFN lambda 1, Storage: 4 deg C, Size: 50UG

Sale

Supplier: ACROBIOSYSTEMS

Description: Carbonic Anhydrase IX/CA9 (138-414) Protein, Host: HEK293, Species Reactivity: Human, Purity: >95% by SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at C-terminus, MW of 30.9 kDa, Synonym: CAIX,CA9,CA-IX, Storage: 4 deg C, Size: 1mg

Supplier: ACROBIOSYSTEMS

Description: FOLR1 Protein, Strep Tag, Host: HEK293 Cells, Species reactivity: Human, Purity: >95% as determined by SDS-PAGE, Molecular Characterization: Twin Strep Tag is Fused with Twin-Strep tag at the C-terminus, MW 27.6 kDa, Synonym: FOLR-1, FBP, FOLR, Size: 25ug

Supplier: ACROBIOSYSTEMS

Description: Human CXCR4/CD184 Protein, Fc Tag, Host: HEK293 cells, Species Reactivity: Human, purity: >95% SDS-PAGE, Molecular Characterization: fused with a human IgG1 Fc tag at the N-terminus, MW of 32.8 kDa, Synonym: CXCR4, CD184, Fusin, D2S201E, size: 1mg

Supplier: ACROBIOSYSTEMS

Description: TWEAK R/TNFRSF12 Protein, Fc Tag, Host: HEK293, Species Reactivity: Human, Purity: >95% by SDS-PAGE, Molecular Characterization: fused with a human IgG1 Fc tag at N-terminus, MW of 33 kDa, Synonym: TNFRSF12A,FGF-inducible 14, Storage: 4 deg C, Size: 1mg

Catalog Number: (103006-920)

Supplier: Anaspec Inc

Description: This is the immunodominant epitope gB-8p from herpes simplex virus (HSV) glycoprotein B (gB), amino acids 498 to 505.
Sequence:SSIEFARL
MW:922.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale