Print…

You Searched For: 3,4-Diaminoanisole


613,157  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"613157"

Rate These Search Results

Image Unavailable-103003-038

Beta-Amyloid (1-33) 1mg

Description: Beta-Amyloid (1-33), Human, Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 3674, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG, Purified metalloendopeptidase cleaves the Gly33-Leu34 bond of Alzheimer AEszett (1-40) peptide, Storage: At -20 degree C, Size: 1mg
Catalog Number: 103003-038
Supplier: Anaspec Inc
Image Unavailable-103007-524

Beta-Amyloid (3-42) Human 0.1 mg

Description: Beta-Amyloid (3-42), Human, Sequence: EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Purity: By HPLC greater than or equal to 95%, Molecular Weight: 4327.9, Apperance: Lyophilized white powder, Storage: -20 deg C, Size: 0.1 mg
Catalog Number: 103007-524
Supplier: Anaspec Inc
Image Unavailable-103007-100

[NMeG24, NMeI26] Human Islet Amyloid Polypeptide (IAPP) (22-27) 1 mg

Description: [NMeG24, NMeI26] Human Islet Amyloid Polypeptide (IAPP) (22-27), a modification of human islet amyloid polypeptide Hiapp, Sequence: NF-(NMe-G)-A-(NMe-I)-L, Purity: HPLC >/= 95%, Molecular Weight: 661.8, Size: 1 mg
Catalog Number: 103007-100
Supplier: Anaspec Inc
Product Image-JT2710-1

Molecular Sieve, Activated, Type 3A, BAKER ANALYZED® Reagent

Description: Molecular Sieve, Activated, Type 3A, BAKER ANALYZED® Reagent
Catalog Number: JT2710-1
Supplier: AVANTOR PERFORMANCE MATERIAL LLC

SDS Certificates


Product Image-JT2710-5

Molecular Sieve, Activated, Type 3A, BAKER ANALYZED® Reagent

Description: Molecular Sieve, Activated, Type 3A, BAKER ANALYZED® Reagent
Catalog Number: JT2710-5
Supplier: AVANTOR PERFORMANCE MATERIAL LLC

SDS Certificates


Image Unavailable-100201-466

(S)-(+)-(3,5-Dioxa-4-phospha-cyclohepta[2,1-a;3,4-a']dinaphthalen-4-yl)dimethylaMine

Description: (S)-(+)-(3,5-Dioxa-4-phospha-cyclohepta[2,1-a;3,4-a']dinaphthalen-4-yl)dimethylaMine, purity: Min 97%, CAS number: 185449-80-3, molecular Formula: C22H18NO2P, Color: white, Form: crystalline, Size: 1g
Catalog Number: 100201-466
Supplier: Strem Chemicals Inc
Image Unavailable-103007-748

Beta-Amyloid (11-17) Human 1 mg

Description: Beta-Amyloid (11-17), Human, Sequence: EVHHQKL, Purity: By HPLC greater than or equal to 95%, This is a short fragment of the b-Amyloid peptide containing Histidine 13 and 14, Molecular Weight: 890, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-748
Supplier: Anaspec Inc
Image Unavailable-103384-560

Dimethyl Sulfoxide-D6, 100g

Description: Dimethyl Sulfoxide-D6, (D 99.9% PCT), Purity: 99.5%, Cas number: 67-68-5, Molecular formula: CD3SOCD3, Molecular weight: 84.17, Appearance: Clear liquid, Size: 100g
Catalog Number: 103384-560
Supplier: Cambridge Isotope Labs Inc
Image Unavailable-102999-366

Calcitonin Gene Related Peptide 1 mg

Description: Calcitonin Gene Related Peptide, CGRP (8 - 37), human, Sequence: VTHRLAGLLSRSGGVVKNNFVPTNVGSKAF - NH2, CGRP receptor antagonist, Purity: HPLC greater than or equal to 95%, Molecular Weight: 3125.6, Storage: -20 deg C, Size: 1 mg
Catalog Number: 102999-366
Supplier: Anaspec Inc
Image Unavailable-103014-308

Human Cathepsin B/CTSB Protein 1MG

Description: Cathepsin B / CTSB Protein, Host: HEK293 Cell, Species Reactivity: Human, Purity: >95%, Molecular Characterization: CTSB is fused with a polyhistidine tag at the C-terminus, MW of 36.7 kDa, Synonym: CTSB,CPSB,APPS, Storage: 4 deg C, Size: 1MG
Catalog Number: 103014-308
Supplier: ACROBIOSYSTEMS
Image Unavailable-103388-592

Plasminogen MAb Sample Pack 1 Pack

Description: Plasminogen MAb Sample Pack, Host: Mouse, Species: Human, Molecular weight: 160000, Extinction Coefficient: 1.36, Application: ELISA, Western blot, Purity: IgG fraction, Form: Frozen liquid, Buffer: 0.05M Sodium Phosphate, 0.1M NaCl, 1mM EDTA, Size: 1 Pack
Catalog Number: 103388-592
Supplier: Innovative Research Inc
Image Unavailable-103388-454

Factor XII Polyclonal antibody 1mg

Description: Factor XII Polyclonal antibody, Host: Sheep, Species: Human, Isotype: IgG, Molecular weight: 80KDa, Antigen: Full length native protein (purified) (Human), Application: ELISA, Western Blot, Purity: Serum, Form: Frozen liquid, Storage: -70 deg C, Size: 1mg
Catalog Number: 103388-454
Supplier: Innovative Research Inc
Image Unavailable-103388-368

Factor X Monoclonal antibody 0.5mg

Description: Factor X Monoclonal antibody, Clone: 9050, Host: Rat, Species: Mouse, Target Molecular weight: 58900, Antigen: Full length native protein (purified) (Mouse), Application: ELISA, Western Blot, Purity: IgG fraction, Form: Liquid, Storage: -20 deg C, Size: 0.5mg
Catalog Number: 103388-368
Supplier: Innovative Research Inc
Image Unavailable-103385-900

Factor XII Polyclonal antibody 0.1mg

Description: Factor XII Polyclonal antibody, Host: Sheep, Species: Human, Isotype: IgG, Molecular weight: 80KDa, Antigen: Full length native protein (purified) (Human), Application: ELISA, Western Blot, Purity: Serum, Form: Frozen liquid, Storage: -70 deg C, Size: 0.1mg
Catalog Number: 103385-900
Supplier: Innovative Research Inc
Image Unavailable-103388-864

Factor X Monoclonal antibody 0.1mg

Description: Factor X Monoclonal antibody, Clone: 9050, Host: Rat, Species: Mouse, Target Molecular weight: 58900, Antigen: Full length native protein (purified) (Mouse), Application: ELISA, Western Blot, Purity: IgG fraction, Form: Liquid, Storage: -20 deg C, Size: 0.1mg
Catalog Number: 103388-864
Supplier: Innovative Research Inc
Image Unavailable-103006-384

V5 Epitope Tag 1 mg

Description: V5 Epitope Tag sequence is from the C-terminal sequence of the P and V proteins of Simian Virus 5, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): GKPIPNPLLGLDST, Molecular Weight: 1421.7, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-384
Supplier: Anaspec Inc
1 - 16 of 613,157