Print…

You Searched For: membrane pumps


613,157  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"613157"

Rate These Search Results

Image Unavailable-102996-560

Peptide YY 1 mg

Description: Peptide YY, human, Purity: HPLC >/= to 95%, Molecular Weight: 4309.8, Sequence: YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, Appearance: Lyophilized white powder, is a 36-amino acid regulatory gut hormone present in endocrine cells in the intestine, Storage: -20 deg C, Size: 1 mg
Catalog Number: 102996-560
Supplier: Anaspec Inc
Image Unavailable-76303-788

Recom Il-8 77Aa Cxcl8 >/= 98% Human 50Ug

Description: IL-8 77AA CXCL8 Recombinant, Purity: > 98% by SDS-PAGE gel and HPLC, Source: E.coli, Reactivity: Human, Molecular mass of 8.9 kDa protein containing 77 aa residues, Synonyms: CXCL8, monocyte-derived neutrophil chemotactic factor, NAP-1, Size: 50 uG
Catalog Number: 76303-788
Supplier: PeproTech, Inc.
Image Unavailable-103007-326

Tetanus Toxin (830–844) 1 mg

Description: Tetanus Toxin (830–844), Sequence: QYIKANSKFIGITEL, Purity: By HPLC >/= 95%, This peptide belongs to 830 to 844 amino acid sequence of the tetanus toxin Tc, human, common for most MHC molecules, Molecular Weight: 1725, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-326
Supplier: Anaspec Inc
Image Unavailable-103009-012

Histone H3 (5-23) 1mg

Description: Histone H3 (5-23), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2013.3, Sequence: QTARKSTGGKAPRKQLASK, peptide represents amino acid residues 5-23 of histone H3 and used as substrate for histone acetyl-transferase (HAT) assay, Storage: -20 degree C, Size: 1mg
Catalog Number: 103009-012
Supplier: Anaspec Inc
Image Unavailable-103007-368

Delta - Toxin (1 - 26) 1 mg

Description: Delta - Toxin (1 - 26), Staphylococcus aureus, Sequence: MAQDIISTIGDLVKWIIDTVNKFTKK, Purity: By HPLC greater than or equal to 95%, 26-residue hemolytic peptide secreted by Staphylococcus aureus, Molecular Weight: 2978.6, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-368
Supplier: Anaspec Inc
Image Unavailable-103008-684

Histone H4 (8-25)-WC 1mg

Description: Histone H4 (8-25)-WC, amide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2278.7, Sequence: KGLGKGGAKRHRKVLRDNWC-NH2, amidated version of Histone H4 residues 8-25. It contains two additional residues (WC) on its C-terminus, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-684
Supplier: Anaspec Inc
Product Image-76481-750

BOC-Statine [BOC-Sta(3S,4S)-OH] CAS 58521-49-6, (3S,4S)-Statine a novel amino acid of pepstatin, a low MW inhibitor of acid proteases, BOC-Statine building lock a very useful precursor for preparing protease-resistant peptide for pharmacetical application using st/ard BOC chemistry, Size: 1g

Description: BOC-Statine [BOC-Sta(3S,4S)-OH] CAS 58521-49-6, (3S,4S)-Statine a novel amino acid of pepstatin, a low MW inhibitor of acid proteases, BOC-Statine building lock a very useful precursor for preparing protease-resistant peptide for pharmacetical application using st/ard BOC chemistry, Size: 1g
Catalog Number: 76481-750
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Image Unavailable-103003-138

CREBtide [KRREILSRRPSYR] 5 mg

Description: CREBtide [KRREILSRRPSYR], Purity: HPLC >/- 95%, Molecular Weight: 2075.3, Sequence: 5-FAM-Lys-Arg-Arg-Glu-Ile-Leu-Ser-Arg-Arg-Pro-Ser-Tyr-Arg-OH, label: 5-FAM, Appearance: Lyophilized yellow powder, is a synthetic substrate for PKA, Storage: -20 deg C, Size: 5 mg
Catalog Number: 103003-138
Supplier: Anaspec Inc
Image Unavailable-103385-416

Factor IX Monoclonal antibody 0.1mg

Description: Factor IX Monoclonal antibody, Clone: 9042, Host: Rat, Species: Mouse, Target Molecular weight: 56 Kda, Antigen: Full length native protein (purified) (Mouse), Application: ELISA, Western Blot, Purity: IgG fraction, Form: Liquid, Storage: -20 deg C, Size: 0.1mg
Catalog Number: 103385-416
Supplier: Innovative Research Inc
Image Unavailable-103388-362

Factor IX Monoclonal antibody 0.5mg

Description: Factor IX Monoclonal antibody, Clone: 9042, Host: Rat, Species: Mouse, Target Molecular weight: 56 Kda, Antigen: Full length native protein (purified) (Mouse), Application: ELISA, Western Blot, Purity: IgG fraction, Form: Liquid, Storage: -20 deg C, Size: 0.5mg
Catalog Number: 103388-362
Supplier: Innovative Research Inc
Image Unavailable-103002-830

M13 Skeletal Muscle Myosin Light Chain Kinase Peptide 1mg

Description: M13 Skeletal Muscle Myosin Light Chain Kinase Peptide, SK - MLCK M13, Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 2964.5, Sequence: (One-Letter Code) KRRWKKNFIAVSAANRFKKISSSGAL, Storage: At -20 degree C, Size: 1mg
Catalog Number: 103002-830
Supplier: Anaspec Inc
Image Unavailable-102998-430

ACTH (7 - 38), human 1mg

Description: ACTH (7 - 38), human, Purity: % Peak Area By HPLC >/=95%, Molecular Weight 3659.2, the 7-38 fragment of human ACTH (1-39), Sequence (One-Letter Code): FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE, act as an antagonist of ACTH receptors, Storage -20 deg C, Size: 1mg
Catalog Number: 102998-430
Supplier: Anaspec Inc
Image Unavailable-103002-832

M13 Skeletal Muscle Myosin Light Chain Kinase Peptide 5mg

Description: M13 Skeletal Muscle Myosin Light Chain Kinase Peptide, SK - MLCK M13, Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 2964.5, Sequence: (One-Letter Code) KRRWKKNFIAVSAANRFKKISSSGAL, Storage: At -20 degree C, Size: 5mg
Catalog Number: 103002-832
Supplier: Anaspec Inc
Image Unavailable-103007-478

Deltorphin A 1 mg

Description: Deltorphin A, Sequence: YmFHLMD-NH2, Purity: By HPLC >/= 95%, peptide was isolated from skin extracts of the South American frog, Phyllomedusa sauvagei, a potent and selective agonist for the delta-opioid receptor, Molecular Weight: 955.2, Storage: -20 C, Size: 1 mg
Catalog Number: 103007-478
Supplier: Anaspec Inc
Image Unavailable-103008-440

OVA (323-339) 1mg

Description: OVA (323-339), Purity: Greater than or equal to 95% (HPLC), Formula: C84H134N28O27S1, Molecular weight: 2000.2, Sequence: Biotin-ISQAVHAAHAEINEAGR, Label: Biotin, Appearance: Powder, N-terminal OVA Peptide, amino acids 323 to 339, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-440
Supplier: Anaspec Inc
Image Unavailable-103002-842

OVA (257-264) [SIINFEKL] 1mg

Description: OVA (257-264) [SIINFEKL], Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 963.2, Sequence: (One-Letter Code) SIINFEKL, class I (Kb)-restricted peptide epitope of OVA, an octameric peptide, Appearance: white powder, Storage: At -20 degree C, Size: 1mg
Catalog Number: 103002-842
Supplier: Anaspec Inc
1,665 - 1,680 of 613,157