You Searched For: RHEO+ENGINEERING+LLC+TE


613,155  results were found

SearchResultCount:"613155"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (103385-936)
Supplier: Innovative Research Inc
Description: PSA Polyclonal antibody, Host: Sheep, Species: Human, Isotype: IgG, Molecular weight: 34 Kda, Conjugate: Biotin, Antigen: Full length native protein (purified) (Human), Application: ELISA, Western blot, Purity: Serum, Form: Frozen liquid, Storage: -70 deg C, Size: 1mg


Catalog Number: (103387-634)
Supplier: Innovative Research Inc
Description: RAP Polyclonal antibody, Host: Sheep, Species: Human, Isotype: IgG, Molecular weight: 39 Kda, Antigen: Recombinant full length wild-type human protein (Non-glycosylated), Application: ELISA, WB, Purity: Serum, Form: Frozen liquid, Storage: -70 deg C, Size: 10ml


Catalog Number: (103003-354)
Supplier: Anaspec Inc
Description: Angiotensin III, Purity: HPLC >/- 95%, Molecular Weight: 931.1, Sequence: H-Arg-Val-Tyr-Ile-His-Pro-Phe-OH, Appearance: Powder, Storage: -20 deg C, Size: 5 mg


Catalog Number: (102999-366)
Supplier: Anaspec Inc
Description: Calcitonin Gene Related Peptide, CGRP (8 - 37), human, Sequence: VTHRLAGLLSRSGGVVKNNFVPTNVGSKAF - NH2, CGRP receptor antagonist, Purity: HPLC greater than or equal to 95%, Molecular Weight: 3125.6, Storage: -20 deg C, Size: 1 mg


Catalog Number: (10774-820)
Supplier: PeproTech, Inc.
Description: Recombinant Human Neuritin, Animal Free, 9.72 kDa polypeptide monomers, each contain 88 AA residues, Neuritin acts as a molecular mediator of neurite outgrowth, neuronal survival, synaptic maturation, Source: E.coli, Cross reactivity: Rat, Purity: >98%, Synonyms: NRN15UG


Catalog Number: (10774-824)
Supplier: PeproTech, Inc.
Description: Recombinant Human Neuritin, Animal Free, 9.72 kDa polypeptide monomers, each containing 88 amino acid residues, Neuritin acts as a molecular mediator of neurite outgrowth, neuronal survival, Source: E.coli, Cross reactivity: Rat, Purity: >98%, Synonyms: CPG15, NRN1100UG


Catalog Number: (10774-822)
Supplier: PeproTech, Inc.
Description: Recombinant Human Neuritin, Animal Free, 9.72 kDa polypeptide monomers, each contain 88 AA residues, Neuritin acts as a molecular mediator of neurite outgrowth, neuronal survival, synaptic maturation, Source: E.coli, Cross reactivity: Rat, Purity: >98%, Synonyms: NRN120UG


Catalog Number: (10774-828)
Supplier: PeproTech, Inc.
Description: Recombinant Human Neuritin, Animal Free, 9.72 kDa polypeptide monomers, each containing 88 amino acid residues, Neuritin acts as a molecular mediator of neurite outgrowth, neuronal survival, Source: E.coli, Cross reactivity: Rat, Purity: >98%, Synonyms: CPG15, NRN1500UG


Catalog Number: (10774-826)
Supplier: PeproTech, Inc.
Description: Recombinant Human Neuritin, Animal Free, 9.72 kDa polypeptide monomers, each containing 88 amino acid residues, Neuritin acts as a molecular mediator of neurite outgrowth, neuronal survival, Source: E.coli, Cross reactivity: Rat, Purity: >98%, Synonyms: CPG15, NRN1250UG


Catalog Number: (10774-830)
Supplier: PeproTech, Inc.
Description: Recombinant Human Neuritin, Animal Free, 9.72 kDa polypeptide monomers, each contain 88 AA residues, Neuritin acts as a molecular mediator of neurite outgrowth, neuronal survival, synaptic maturation, Source: E.coli, Cross reactivity: Rat, Purity: >98%, Synonyms: NRN11MG


Catalog Number: (103006-896)
Supplier: Anaspec Inc
Description: Lymphocytic Choreomeningitis Virus (LCMV) Glycoprotein 33 (33-41), LCMV GP1 H-2Db restricted epitope derived from (LCMV) glycoprotein, Purity: HPLC>/=95%, Sequence (One-Letter Code): KAVYNFATC, Molecular weight: 1383.5, Size: 1 mg


Catalog Number: (103011-336)
Supplier: Anaspec Inc
Description: Dihydrorhodamine 123, Generic substrate for fluorimetric detection of oxidases (including peroxidase) in mitochondria, Molecular Weight: 346.38, Spectral Properties: Abs/Em = 507/529 nm, Solvent System: DMSO, CAS number: 109244-58-8, MF: C21H18N2O3, Size: 10 mg


Catalog Number: (102999-616)
Supplier: Anaspec Inc
Description: Cys - beta - Amyloid (1 - 42), Human, Sequence: CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4617.3, Apperance: Powder, Storage: -20 deg C, Size: 0.5 mg


Catalog Number: (102999-618)
Supplier: Anaspec Inc
Description: Cys - beta - Amyloid (1 - 42), Human, Sequence: CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4617.3, Apperance: Powder, Storage: -20 deg C, Size: 0.1 mg


Catalog Number: (102996-280)
Supplier: Anaspec Inc
Description: Kemptide [LRRASLG], Purity: HPLC >/= to 95%, Molecular Weight: 771.9, Sequence: H-Leu-Arg-Arg-Ala-Ser-Leu-Gly-OH, Appearance: Lyophilized white powder, Peptide Reconstitution: freely soluble in water, is a phosphate acceptor peptide, Storage: -20 deg C, Size: 5 mg


Catalog Number: (103006-552)
Supplier: Anaspec Inc
Description: LCMV gp33-41 H-2Db restricted epitope derived from the lymphocytic choreomeningitis virus (LCMV) glycoprotein gp 33, Purity: HPLC>/=95%, Sequence (One-Letter Code): KAVYNFATM, Molecular weight: 1044.3, Physical State: Lyophilized White Powder, Storage: -20 degree C, Size: 1 mg


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,273 - 2,288 of 613,155
no targeter for Bottom