Print…

You Searched For: Molecular+Bioproducts+Inc.


613,157  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"613157"

Rate These Search Results

Image Unavailable-102999-618

Cys - beta - Amyloid (1 - 42) 0.1 mg

Description: Cys - beta - Amyloid (1 - 42), Human, Sequence: CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4617.3, Apperance: Powder, Storage: -20 deg C, Size: 0.1 mg
Catalog Number: 102999-618
Supplier: Anaspec Inc
Image Unavailable-103374-150

7084-24-4 1MG

Description: 2-(3,4-Dihydroxyphenyl)-3-(beta-D-glucopyranosyloxy)-5,7-dihydroxy-1-benzopyrylium chloride, Purity: 95.0% HPLC, CAS Number: 7084-24-4, Molecular Formula: C21H21ClO11, Molecular weight: 484.84 g/mol, Synonyms: Asterin; Chrysanthemin; Kuromanin chloride, Form: powder, size: 1MG
Catalog Number: 103374-150
Supplier: Biosynth International Inc

SDS


Image Unavailable-103374-154

7084-24-4 5MG

Description: 2-(3,4-Dihydroxyphenyl)-3-(beta-D-glucopyranosyloxy)-5,7-dihydroxy-1-benzopyrylium chloride, Purity: 95.0% HPLC, CAS Number: 7084-24-4, Molecular Formula: C21H21ClO11, Molecular weight: 484.84 g/mol, Synonyms: Asterin; Chrysanthemin; Kuromanin chloride, Form: powder, size: 5MG
Catalog Number: 103374-154
Supplier: Biosynth International Inc

SDS


Image Unavailable-103374-152

7084-24-4 2.5MG

Description: 2-(3,4-Dihydroxyphenyl)-3-(beta-D-glucopyranosyloxy)-5,7-dihydroxy-1-benzopyrylium chloride, Purity: 95.0% HPLC, CAS Number: 7084-24-4, Molecular Formula: C21H21ClO11, Molecular weight: 484.84 g/mol, Synonyms: Asterin; Chrysanthemin; Kuromanin chloride, Form: powder, size: 2.5MG
Catalog Number: 103374-152
Supplier: Biosynth International Inc

SDS


Image Unavailable-103374-156

7084-24-4 10MG

Description: 2-(3,4-Dihydroxyphenyl)-3-(beta-D-glucopyranosyloxy)-5,7-dihydroxy-1-benzopyrylium chloride, Purity: 95.0% HPLC, CAS Number: 7084-24-4, Molecular Formula: C21H21ClO11, Molecular weight: 484.84 g/mol, Synonyms: Asterin; Chrysanthemin; Kuromanin chloride, Form: powder, size: 10MG
Catalog Number: 103374-156
Supplier: Biosynth International Inc

SDS


Image Unavailable-103011-336

Dihydrorhodamine 123 10 mg

Description: Dihydrorhodamine 123, Generic substrate for fluorimetric detection of oxidases (including peroxidase) in mitochondria, Molecular Weight: 346.38, Spectral Properties: Abs/Em = 507/529 nm, Solvent System: DMSO, CAS number: 109244-58-8, MF: C21H18N2O3, Size: 10 mg
Catalog Number: 103011-336
Supplier: Anaspec Inc
Image Unavailable-102996-280

Kemptide [LRRASLG] 5 mg

Description: Kemptide [LRRASLG], Purity: HPLC >/= to 95%, Molecular Weight: 771.9, Sequence: H-Leu-Arg-Arg-Ala-Ser-Leu-Gly-OH, Appearance: Lyophilized white powder, Peptide Reconstitution: freely soluble in water, is a phosphate acceptor peptide, Storage: -20 deg C, Size: 5 mg
Catalog Number: 102996-280
Supplier: Anaspec Inc
Image Unavailable-103006-552

LCMV gp33-41 1 mg

Description: LCMV gp33-41 H-2Db restricted epitope derived from the lymphocytic choreomeningitis virus (LCMV) glycoprotein gp 33, Purity: HPLC>/=95%, Sequence (One-Letter Code): KAVYNFATM, Molecular weight: 1044.3, Physical State: Lyophilized White Powder, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-552
Supplier: Anaspec Inc
Image Unavailable-103008-550

LCMV GP (61-80) 1mg

Description: LCMV GP (61-80), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2290.6, Sequence: GLKGPDIYKGVYQFKSVEFD, Appearance: Powder, amino acids 61 to 80 fragment of the Lymphocytic Choriomeningitis Virus (LCMV) Glycoprotein (GP), Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-550
Supplier: Anaspec Inc
Image Unavailable-10781-290

Recombinant Human Pleiotrophin

Description: Recombinant Human Pleiotrophin is a 15.4kDa protein containing 136 amino acid residues and five intra-molecular disulfide bonds, Animal free, Source: E.coli, Cross Reactivity: Bacteria, Mouse, Rat, Purity: > 98%, Synonyms: PTN, Heparin Affin Regulatory Protein, 250ug
Catalog Number: 10781-290
Supplier: PeproTech, Inc.
Image Unavailable-10781-288

Recombinant Human Pleiotrophin

Description: Recombinant Human Pleiotrophin is a 15.4kDa protein containing 136 amino acid residues and five intra-molecular disulfide bonds, Animal free, Source: E.coli, Cross Reactivity: Bacteria, Mouse, Rat, Purity: > 98%, Synonyms: PTN, Heparin Affin Regulatory Protein, 100UG
Catalog Number: 10781-288
Supplier: PeproTech, Inc.
Image Unavailable-10781-292

Recombinant Human Pleiotrophin

Description: Recombinant Human Pleiotrophin is a 15.4kDa protein containing 136 amino acid residues and five intra-molecular disulfide bonds, Animal free, Source: E.coli, Cross Reactivity: Bacteria, Mouse, Rat, Purity: > 98%, Synonyms: PTN, Heparin Affin Regulatory Protein, 500UG
Catalog Number: 10781-292
Supplier: PeproTech, Inc.
Image Unavailable-10781-306

Recombinant Human Midkine

Description: Recombinant Human Midkine is a 13.4 kDa protein containing 123 amino acid residues including five intra-molecular disulfide bonds, Animal free, Source: E.coli, Cross Reactivity: Bacteria, Mouse, Pig, > 98% by SDS-PAGE gel and HPLC analyses, Synonyms: MK, NEGF-2, 1MG
Catalog Number: 10781-306
Supplier: PeproTech, Inc.
Image Unavailable-10781-302

Recombinant Human Midkine

Description: Recombinant Human Midkine is a 13.4 kDa protein containing 123 amino acid residues including five intra-molecular disulfide bonds, Animal free, Source: E.coli, Cross Reactivity: Bacteria, Mouse, Pig, > 98% by SDS-PAGE gel and HPLC analyses, Synonyms: MK, NEGF-2, 250ug
Catalog Number: 10781-302
Supplier: PeproTech, Inc.
Image Unavailable-10781-296

Recombinant Human Midkine

Description: Recombinant Human Midkine is a 13.4 kDa protein containing 123 amino acid residues including five intra-molecular disulfide bonds, Animal free, Source: E.coli, Cross Reactivity: Bacteria, Mouse, Pig, > 98% by SDS-PAGE gel and HPLC analyses, Synonyms: MK, NEGF-2, 5UG
Catalog Number: 10781-296
Supplier: PeproTech, Inc.
Image Unavailable-10781-298

Recombinant Human Midkine

Description: Recombinant Human Midkine is a 13.4 kDa protein containing 123 amino acid residues including five intra-molecular disulfide bonds, Animal free, Source: E.coli, Cross Reactivity: Bacteria, Mouse, Pig, > 98% by SDS-PAGE gel and HPLC analyses, Synonyms: MK, NEGF-2, 20UG
Catalog Number: 10781-298
Supplier: PeproTech, Inc.
1,169 - 1,184 of 613,157