Print…

You Searched For: Molecular+Bioproducts+Inc.


377,326  results were found

Refine Results Sort by
SearchResultCount:"377326"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-102996-536

Human beta-Endorphin

Catalog Number: (102996-536)
Supplier: Anaspec Inc
Description: β-Endorphin is an endogenous opioid neuropeptide found in the neurons of both the central and peripheral nervous system.
Sequence:YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
MW:3465.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103012-152

Mouse Recombinant 4-1BB (from HEK293 cells), Fc Tag

Supplier: ACROBIOSYSTEMS
Description: Mouse 4-1BB /TNFRSF9 Protein, Fc Tag, Host: HEK293 cells, Species Reactivity: mouse, purity: >92% SDS-PAGE, Molecular Characterization: fused with a human IgG1 Fc tag at the C-terminus, MW of 46.7 kDa, Synonym: TNFRSF9,4-1BB,CD137,CDw137,ILA, size: 100ug

Image Unavailable-103013-810

Human Recombinant DcR3 (from HEK293 Cells), Fc Tag

Catalog Number: (103013-810)
Supplier: ACROBIOSYSTEMS
Description: DcR3/TNFRSF6B Protein, Fc Tag, Host: HEK293 cells, Species Reactivity: Human, Purity: >85% (SDS-PAGE), Molecular Characterization: Fc Chimera fused with human IgG1 Fc tag at C-terminus, MW 56.4KDa, Synonyms: TNFRSF6B, DCR3, TR6, Storage: 4 deg C, Size: 50ug
Image Unavailable-103012-146

Human Recombinant 4-1BB (from HEK293 cells), Fc Tag

Supplier: ACROBIOSYSTEMS
Description: Human 4-1BB/TNFRSF9 Protein, Fc Tag, Host: HEK293 cells, Species Reactivity: Human, purity: >95% SDS-PAGE, Molecular Characterization: fused with a human IgG1 Fc tag at the C-terminus, MW of 43.3 kDa, Synonym: TNFRSF9,4-1BB,CD137,CDw137,ILA, size: 1mg

Image Unavailable-103015-362

Human Recombinant S100P (from E. coli)

Supplier: ACROBIOSYSTEMS
Description: S100P/S100E Protein, Tag Free, Host: E.coli, Species Reactivity: Human, Purity: >95% by SDS-PAGE, Molecular Characterization: contains no tag, calculated MW of 10.4 kDa, Endotoxin: < 1.0 EU per ug, Synonym: S100P,S100E,MIG9, Storage: 4 deg C, Size: 100ug

Image Unavailable-103012-278

Human Recombinant BTLA (from HEK293 cells), Fc Tag

Supplier: ACROBIOSYSTEMS
Description: Human BTLA (31-150) Protein, Fc Tag, Host: HEK293 cells, Species Reactivity: Human, purity: >92% SDS-PAGE, Molecular Characterization: fused with a human IgG1 Fc tag at the C-terminus, MW of 40.4 kDa, Synonym: BTLA,CD272, Storage: 4 Degree C, size: 1mg

Image Unavailable-103014-460

Human Recombinant ICAM-1 (from HEK293 cells), Fc Tag

Supplier: ACROBIOSYSTEMS
Description: ICAM-1/CD54 Protein, Fc Tag, Host: HEK293 Cells, Species reactivity: Human, Purity: >98%SDS-PAGE, Molecular Characterization: Fc Tag is Fused with a human IgG1 Fc tag at the C-terminus, MW of 75.7 kDa, Synonym: ICAM1, BB2, CD54, P3.58, Size: 200ug

Image Unavailable-103015-052

Human Recombinant TrkB (from HEK293 Cells), Fc Tag

Supplier: ACROBIOSYSTEMS
Description: TrkB/NTRK2 Protein, Fc Tag, Host: HEK293, Species Reactivity: Human, Purity: >98% by SDS-PAGE, Molecular Characterization: fused with a human IgG1 Fc tag at the C-terminus, calculated MW of 70.4 kDa, Synonym: NTRK2,TRKB,GP145-TrkB, Storage: 4 deg C, Size: 1mg

Image Unavailable-103014-078

Human Recombinant CD5 (from HEK293 Cells)

Supplier: ACROBIOSYSTEMS
Description: CD5 Protein, Host: HEK293 cells, Species Reactivity: Human, Purity: >95% (SDS-PAGE), Molecular Characterization: rh CD5 /LEU1 is fused with a polyhistidine tag at the C-terminus, with calculated MW of of 40.5 KDa, Synonyms: CD5,LEU1, Storage: 4 degree C, Size: 100ug

Image Unavailable-103012-174

Human Recombinant Activin RIIB (from HEK293 cells)

Supplier: ACROBIOSYSTEMS
Description: Human Activin RIIB/ACVR2B Protein, Host: HEK293 cells, Species Reactivity: Human, purity: >97% SDS-PAGE, Molecular Characterization: His Tag is fused with a polyhistidine tag at the C-terminus, MW of 14.5 kDa, Synonym: ACVR2B, Storage: 4 deg C, size: 1mg

Image Unavailable-103013-734

Human Recombinant Serpin A3 (from HEK293 Cells)

Supplier: ACROBIOSYSTEMS
Description: Serpin A3 Protein, Host: HEK293 cells, Species Reactivity: Human, Purity: >95% (SDS-PAGE), Molecular Characterization: Fused with polyhistidine tag at the C-terminus, MW of 46 KDa, Synonyms: SERPINA3, ACT, AACT, GIG24, GIG25, Storage: 4 degree C, Size: 1mg

Image Unavailable-103014-444

Human Recombinant SOST (from HEK293 Cells)

Supplier: ACROBIOSYSTEMS
Description: SOST / Sclerostin Protein, Host: HEK293 Cells, Species Reactivity: Human, purity: >95%, Molecular Characterization: His Tag is fused with a polyhistidine tag at the N-terminus, Less than 1.0 EU per ug , Synonym: SOST,VBCH, Storage: 4 deg C, Size: 100UG

Image Unavailable-103013-880

Human Recombinant TYRO3 (from HEK293 Cells), Fc Tag

Supplier: ACROBIOSYSTEMS
Description: TYRO3/Dtk Protein, Fc Tag, Host: HEK293 cells, Species Reactivity: Human, Purity: >95% (SDS-PAGE), Molecular Characterization: Fc Chimera fused with Fc fragment of human IgG1 at C-terminus, MW 68.2KDa, Synonyms: TYRO3, BYK, DTK, RSE, Storage: 4 deg C, Size: 200ug

Image Unavailable-103014-378

Human Recombinant GFR alpha-1 (from HEK293 Cells)

Supplier: ACROBIOSYSTEMS
Description: GFR alpha-1 Protein, Host: HEK293 Cells, Species Reactivity: Human, purity: >95%, Molecular Characterization: MW of 45.5 kDa, Endotoxin: Less than 1.0 EU per ug, Synonym: GFRA1,GDNFRA,RETL1,TRNR1,GDNFR,GFR-ALPHA-1,RET1L, Storage: 4 deg C, Size: 1MG

Image Unavailable-103013-308

Cynomolgus macaque;Rhesus macaque Recombinant IL-4 R alpha (from HEK293 cells)

Supplier: ACROBIOSYSTEMS
Description: IL-4 R alpha/CD124 Protein, Host: HEK293 Cells, Species reactivity: Cynomolgus, Purity: >95%SDS-PAGE, Molecular Characterization: His Tag is Fused with a polyhistidine tag at the C-terminus, MW of 25.6 kDa, Synonym: IL4R, CD124, IL4RA, Size: 1mg

Image Unavailable-103013-984

Human Recombinant VSIG4 (from HEK293 Cells)

Supplier: ACROBIOSYSTEMS
Description: VSIG4 Protein, Host: HEK293 cells, Species Reactivity: Human, Purity: >95% (SDS-PAGE), Molecular Characterization: rh VSIG4, fused with 6xHis tag at the C-terminus, has a calculated MW of 30 KDa, Synonyms: VSIG4, CRIg, Z39IG, Storage: 4 degree C, Size: 1mg

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,169 - 1,184 of 377,326
no targeter for Bottom