Print…

You Searched For: Molecular+Bioproducts+Inc.


613,155  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"613155"

Rate These Search Results

Image Unavailable-10774-352

Recombinant MURINE MIDKINE

Description: Recombinant MURINE MIDKINE, Animal Free, 13.3 kDa protein containing 120 amino acid residues including five intra-molecular disulfide bonds, MK chemoattracts embryonic neurons, neutrophils and macrophages, Source: E.coli, Purity: >98%, Synonyms: MK, NEGF-25UG
Catalog Number: 10774-352
Supplier: PeproTech, Inc.
Image Unavailable-10774-360

Recombinant MURINE MIDKINE

Description: Recombinant MURINE MIDKINE, Animal Free, 13.3 kDa protein containing 120 amino acid residues including five intra-molecular disulfide bonds, MK chemoattracts embryonic neurons, neutrophils and macrophages, Source: E.coli, Purity: >98%, Synonyms: MK, NEGF-2500UG
Catalog Number: 10774-360
Supplier: PeproTech, Inc.
Image Unavailable-103387-392

Prorenin Monoclonal antibody 1mg

Description: Prorenin Monoclonal antibody, Clone: 4B5-E3, Host: Mouse, Species: Human, Isotype: IgG2b kappa, Molecular weight: 160000, pH: 6.6, Application: ELISA, Blocking, Western Blot, Purity: IgG fraction, Form: Frozen liquid, Storage: -70 degree C, Size: 1mg
Catalog Number: 103387-392
Supplier: Innovative Research Inc
Image Unavailable-103388-372

Protein C Monoclonal antibody 0.5mg

Description: Protein C Monoclonal antibody, Clone: 9071, Host: Rat, Species: Mouse, Molecular weight: 62 Kda, Antigen: Full length native protein (purified) (Mouse), Application: ELISA, Inhibitory antibody, Western Blot, Purity: IgG fraction, Storage: -20 deg C, Size: 0.5mg
Catalog Number: 103388-372
Supplier: Innovative Research Inc
Image Unavailable-103385-650

Prorenin Monoclonal antibody 0.1mg

Description: Prorenin Monoclonal antibody, Clone: 4B5-E3, Host: Mouse, Species: Human, Isotype: IgG2b kappa, Molecular weight: 160000, pH: 6.6, Application: ELISA, Blocking, Western Blot, Purity: IgG fraction, Form: Frozen liquid, Storage: -70 deg C, Size: 0.1mg
Catalog Number: 103385-650
Supplier: Innovative Research Inc
Image Unavailable-103388-888

Factor X Polyclonal antibody 10mg

Description: Factor X Polyclonal antibody, Host: Sheep, Species: Mouse, Isotype: IgG, Molecular weight: 58900, Conjugate: FITC, Antigen: Full length native protein (purified) (Mouse), Application: ELISA, WB, Purity: Serum, Form: Frozen liquid, Storage: -70 deg C, Size: 10mg
Catalog Number: 103388-888
Supplier: Innovative Research Inc
Image Unavailable-103386-016

Factor X Polyclonal antibody 1mg

Description: Factor X Polyclonal antibody, Host: Sheep, Species: Mouse, Isotype: IgG, Molecular weight: 58900, Conjugate: FITC, Antigen: Full length native protein (purified) (Mouse), Application: ELISA, WB, Purity: Serum, Form: Frozen liquid, Storage: -70 deg C, Size: 1mg
Catalog Number: 103386-016
Supplier: Innovative Research Inc
Image Unavailable-103388-110

Protein C Monoclonal antibody 0.1mg

Description: Protein C Monoclonal antibody, Clone: 9071, Host: Rat, Species: Mouse, Molecular weight: 62 Kda, Antigen: Full length native protein (purified) (Mouse), Application: ELISA, Inhibitory antibody, Western Blot, Purity: IgG fraction, Storage: -20 deg C, Size: 0.1mg
Catalog Number: 103388-110
Supplier: Innovative Research Inc
Product Image-76482-948

Strandbrite/Trade G 17655, STRANDBRITE/TRADE G 17655

Description: Strandbrite/Trade G 17655, STRANDBRITE/TRADE G 17655
Catalog Number: 76482-948
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Product Image-76481-006

mBCl [Monochlorobimane] CAS 76421-73-3, Monochloromobimane (mBCl) is essentially nonfluorescent until reacted with a thiol group. It readily reacts with several low molecular weight thiols, including cysteine, glutathione, N-acetylcysteine, mercaptopurine, peptides and plasma thiols, Size: 10mg

Description: mBCl [Monochlorobimane] CAS 76421-73-3, Monochloromobimane (mBCl) is essentially nonfluorescent until reacted with a thiol group. It readily reacts with several low molecular weight thiols, including cysteine, glutathione, N-acetylcysteine, mercaptopurine, peptides and plasma thiols, Size: 10mg
Catalog Number: 76481-006
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Image Unavailable-103003-094

PKG Substrate [RKRSRAE] Glasstide 5 mg

Description: PKG Substrate [RKRSRAE], Glasstide, Purity: HPLC >/- 95%, Molecular Weight: 902, Sequence: H-Arg-Lys-Arg-Ser-Arg-Ala-Glu-OH, is a selective substrate for protein kinase G with a strong preference for PKG IA (Km = 59 uM) over PKG II (Km = 305 uM), Size: 5 mg
Catalog Number: 103003-094
Supplier: Anaspec Inc
Image Unavailable-103387-680

UPA Polyclonal antibody 10ml

Description: UPA Polyclonal antibody, Host: Sheep, Species: Human, Isotype: IgG, Molecular Weight: 54 Kda, Antigen: Recombinant full length wild-type human protein (Glycosylated), Application: ELISA, Western blot, Purity: Serum, Form: Frozen liquid, Storage: -70 deg C, Size: 10ml
Catalog Number: 103387-680
Supplier: Innovative Research Inc
Image Unavailable-103385-978

UPA Polyclonal antibody 1ml

Description: UPA Polyclonal antibody, Host: Sheep, Species: Human, Isotype: IgG, Molecular Weight: 54 Kda, Antigen: Recombinant full length wild-type human protein (Glycosylated), Application: ELISA, Western blot, Purity: Serum, Form: Frozen liquid, Storage: -70 deg C, Size: 1ml
Catalog Number: 103385-978
Supplier: Innovative Research Inc
Image Unavailable-103006-670

[Asn23] - beta - amyloid (1 - 42) Iowa Mutation Human 0.5 mg

Description: [Asn23] - beta - amyloid (1 - 42), Iowa Mutation, Human, Purity: HPLC >/=95%, Sequence (One-Letter Code): DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVVIA, Molecular weight: 4513.1, Physical State: Powder, Storage: -20 degree C, Size: 0.5 mg
Catalog Number: 103006-670
Supplier: Anaspec Inc
Image Unavailable-103006-942

RS domain derived peptide 1 mg

Description: RS domain derived peptide peptide is a substrate for Clk/Sty and is phosphorylated by Clk/Sty protein kinase (Km=102 microM), Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): GRSRSRSRSR, Molecular weight: 1204.3, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103006-942
Supplier: Anaspec Inc
Image Unavailable-103003-382

Phytochelatin 4 PC4 1 mg

Description: Phytochelatin 4, PC4, Purity: HPLC >/- 95%, Molecular Weight: 1004.1, Sequence: H-Y-Glu-Cys-Y-Glu-Cys-Y-Glu-Cys-Y-Glu-Cys-Gly-OH, A glutathione-derived heavy metal-detoxifying peptide of higher plants consisting of 4 units of YGlu-Cys, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103003-382
Supplier: Anaspec Inc
1,105 - 1,120 of 613,155