Print…

You Searched For: Molecular+Bioproducts+Inc.


485,990  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"485990"

Rate These Search Results

Image Unavailable-103003-180

Beta-Amyloid (1-40) 0.1 mg

Description: Beta-Amyloid (1-40), Purity: HPLC >/- 95%, Molecular Weight: 5199, Sequence: HiLyte* Fluor 555-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, label: HiLyte Fluor* 555, Appearance: Lyophilized red powder, this is a fluorescent labeled B-Amyloid peptide, Size: 0.1 mg
Catalog Number: 103003-180
Supplier: Anaspec Inc
Image Unavailable-103003-706

Beta-Amyloid (25-35) 1 mg

Description: Beta-Amyloid (25-35), Human, mouse/rat, Purity: HPLC >/- 95%, Molecular Weight: 1060.3, Sequence: H-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-OH, Appearance: Lyophilized white powder, AB (25-35) is the main factor responsible for AB neurotoxic effects, Size: 1 mg
Catalog Number: 103003-706
Supplier: Anaspec Inc
Image Unavailable-103385-308

IgA2, Human Myeloma Plasma 5mg

Description: IgA2, Human Myeloma Plasma, Purity: >95% by SDS-PAGE analysis, Source: Human myeloma plasma, Molecular Weight: 160,000, Species: Human, Storage: -70 C, Form: Frozen liquid, Preservative: Sodium Azide, Concentration: 1.0 mg/ml, Size: 5mg
Catalog Number: 103385-308
Supplier: Innovative Research Inc
Image Unavailable-103387-002

IgA2, Human Myeloma Plasma 10mg

Description: IgA2, Human Myeloma Plasma, Purity: >95% by SDS-PAGE analysis, Source: Human myeloma plasma, Molecular Weight: 160,000, Species: Human, Storage: -70 C, Form: Frozen liquid, Preservative: Sodium Azide, Concentration: 1.0 mg/ml, Size: 10mg
Catalog Number: 103387-002
Supplier: Innovative Research Inc
Image Unavailable-103385-328

IgG2, Human Myeloma Plasma 5mg

Description: IgG2, Human Myeloma Plasma, Purity: >95% by SDS-PAGE analysis, Source: Human myeloma plasma, Molecular Weight: 146,000, Species: Human, Storage: -70 C, Form: Frozen liquid, Preservative: Sodium Azide, Concentration: 1.0 mg/ml, Size: 5mg
Catalog Number: 103385-328
Supplier: Innovative Research Inc
Image Unavailable-103387-014

IgE, Human Myeloma Plasma 1mg

Description: IgE, Human Myeloma Plasma, Purity: >95% by SDS-PAGE analysis, Source: Human myeloma plasma, Molecular Weight: 200,000, Species: Human, Storage: -70 C, Form: Frozen liquid, Preservative: Sodium Azide, Concentration: 1.0 mg/ml, Size: 1mg
Catalog Number: 103387-014
Supplier: Innovative Research Inc
Image Unavailable-103385-320

IgE, Human Myeloma Plasma 0.1mg

Description: IgE, Human Myeloma Plasma, Purity: >95% by SDS-PAGE analysis, Source: Human myeloma plasma, Molecular Weight: 200,000, Species: Human, Storage: -70 C, Form: Frozen liquid, Preservative: Sodium Azide, Concentration: 1.0 mg/ml, Size: 0.1mg
Catalog Number: 103385-320
Supplier: Innovative Research Inc
Image Unavailable-103387-022

IgG2, Human Myeloma Plasma 10mg

Description: IgG2, Human Myeloma Plasma, Purity: >95% by SDS-PAGE analysis, Source: Human myeloma plasma, Molecular Weight: 146,000, Species: Human, Storage: -70 C, Form: Frozen liquid, Preservative: Sodium Azide, Concentration: 1.0 mg/ml, Size: 10mg
Catalog Number: 103387-022
Supplier: Innovative Research Inc
Image Unavailable-102999-348

Beta - Amyloid (1 - 11), Human, 1mg

Description: Beta - Amyloid (1 - 11), Human, DAEFRHDSGYE, Purity: Peak Area By HPLC greater than or equal to 95%, Physical State: Solid, Molecular Weight: 1325.3, Storage: -20 deg C, size: 1mg
Catalog Number: 102999-348
Supplier: Anaspec Inc
Image Unavailable-103010-638

AggreSure* beta-Amyloid (1-40) 0.25 mg

Description: AggreSure* beta-Amyloid (1-40), human, Peptide Purity: >90%, Molecular Weight: 4329.9, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, Appearance: Lyophilized white powder, this peptide is pretreated and tested for aggregation, size: 0.25 mg
Catalog Number: 103010-638
Supplier: Anaspec Inc
Image Unavailable-103006-240

Histatin - 5 1 mg

Description: Histatin - 5, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): DSHAKRHHGYKRKFHEKHHSHRGY, Molecular Weight: 3036.3, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-240
Supplier: Anaspec Inc
Image Unavailable-103007-546

Biotin-LC-beta-Amyloid (15-25) Human mouse/rat 1 mg

Description: Biotin-LC-beta-Amyloid (15-25), Human, mouse/rat, Sequence: Biotin-LC-QKLVFFAEDVG, Purity: By HPLC greater than or equal to 95%, Molecular Weight: 1591.9, Apperance: powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-546
Supplier: Anaspec Inc
Image Unavailable-103008-216

[Met]-beta-Amyloid (1-42) 0.1mg

Description: [Met]-beta-Amyloid (1-42), human, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 5057.8, Sequence: 5-TAMRA-MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Label: 5-TAMRA, b-amyloid (1-42) peptide with N-term methionine, Storage: -20 degree C, Size: 0.1mg
Catalog Number: 103008-216
Supplier: Anaspec Inc
Image Unavailable-103003-740

Sauvagine 0.5 mg

Description: Sauvagine, Purity: HPLC >/- 95%, Molecular Weight: 4599.4, Sequence: Pyr-GPPISIDLSLELLRKMIEIEKQEKEKQQAANNRLLLDTI-NH2, this peptide is a A hypotensive and diuretic peptide, Originally isolated from the skin of the frog, Phyllomedusa sauvagei, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 103003-740
Supplier: Anaspec Inc
Image Unavailable-102999-378

MBP (4 - 14) 5 mg

Description: MBP (4 - 14), Sequence: QKRPSQRSKYL, Purity: HPLC greater than or equal to 95%, Molecular Weight: 1390.6, A substrate for Protein Kinase C, Apperance: White Powder, Storage: -20 deg C, Size: 5 mg
Catalog Number: 102999-378
Supplier: Anaspec Inc
Product Image-76482-948

Strandbrite/Trade G 17655, STRANDBRITE/TRADE G 17655

Description: Strandbrite/Trade G 17655, STRANDBRITE/TRADE G 17655
Catalog Number: 76482-948
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


1,041 - 1,056 of 485,990