Print…

You Searched For: Molecular+Bioproducts+Inc.


485,990  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"485990"

Rate These Search Results

Image Unavailable-76303-884

Recom E.Coli Midkine >/= 98% Human 50 Ug

Description: MIDKINE Recombinant, Purity: > 98% by SDS-PAGE gel and HPLC, Source: E.coli, Reactivity: Human, Molecular mass of 13.4 kDa protein containing 123 aa residues including five intra-molecular disulfide bonds, Synonyms: MK, NEGF-2, Size: 50 uG
Catalog Number: 76303-884
Supplier: PeproTech, Inc.
Image Unavailable-103007-416

Pyrrhocoricin 1 mg

Description: Pyrrhocoricin, Sequence: VDKGSYLPRPTPPRPIYNRN, Purity: By HPLC greater than or equal to 95%, proline-rich cationic antibacterial peptide pyrrhocoricin kills responsive bacteria, Molecular Weight: 2340.7, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-416
Supplier: Anaspec Inc
Image Unavailable-102999-348

Beta - Amyloid (1 - 11), Human, 1mg

Description: Beta - Amyloid (1 - 11), Human, DAEFRHDSGYE, Purity: Peak Area By HPLC greater than or equal to 95%, Physical State: Solid, Molecular Weight: 1325.3, Storage: -20 deg C, size: 1mg
Catalog Number: 102999-348
Supplier: Anaspec Inc
Image Unavailable-103003-362

DYKDDDDK 5 mg

Description: DYKDDDDK, Purity: HPLC >/- 95%, Molecular Weight: 1013, Appearance: Powder, This epitope tag is a short hydrophilic, highly charged peptide. It is the most widely used epitope tag employed in structural and functional studies of proteins, Storage: -20 deg C, Size: 5 mg
Catalog Number: 103003-362
Supplier: Anaspec Inc
Image Unavailable-103010-638

AggreSure* beta-Amyloid (1-40) 0.25 mg

Description: AggreSure* beta-Amyloid (1-40), human, Peptide Purity: >90%, Molecular Weight: 4329.9, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, Appearance: Lyophilized white powder, this peptide is pretreated and tested for aggregation, size: 0.25 mg
Catalog Number: 103010-638
Supplier: Anaspec Inc
Image Unavailable-103006-240

Histatin - 5 1 mg

Description: Histatin - 5, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): DSHAKRHHGYKRKFHEKHHSHRGY, Molecular Weight: 3036.3, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-240
Supplier: Anaspec Inc
Image Unavailable-103007-546

Biotin-LC-beta-Amyloid (15-25) Human mouse/rat 1 mg

Description: Biotin-LC-beta-Amyloid (15-25), Human, mouse/rat, Sequence: Biotin-LC-QKLVFFAEDVG, Purity: By HPLC greater than or equal to 95%, Molecular Weight: 1591.9, Apperance: powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-546
Supplier: Anaspec Inc
Image Unavailable-103008-216

[Met]-beta-Amyloid (1-42) 0.1mg

Description: [Met]-beta-Amyloid (1-42), human, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 5057.8, Sequence: 5-TAMRA-MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Label: 5-TAMRA, b-amyloid (1-42) peptide with N-term methionine, Storage: -20 degree C, Size: 0.1mg
Catalog Number: 103008-216
Supplier: Anaspec Inc
Image Unavailable-103007-602

[Arg6]-beta-Amyloid (1-40) English Mutation 0.5 mg

Description: [Arg6]-beta-Amyloid (1-40), English Mutation, Sequence: DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, Purity: By HPLC greater than or equal to 95%, Molecular Weight: 4348.9, Apperance: Powder, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 103007-602
Supplier: Anaspec Inc
Image Unavailable-103003-740

Sauvagine 0.5 mg

Description: Sauvagine, Purity: HPLC >/- 95%, Molecular Weight: 4599.4, Sequence: Pyr-GPPISIDLSLELLRKMIEIEKQEKEKQQAANNRLLLDTI-NH2, this peptide is a A hypotensive and diuretic peptide, Originally isolated from the skin of the frog, Phyllomedusa sauvagei, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 103003-740
Supplier: Anaspec Inc
Image Unavailable-100204-576

360048-63-1

Description: (R)-(-)-1-{(S)-2-[Bis(3,5-dimethyl-4-methoxyphenyl)phosphino]ferrocenyl}ethyldicyclohexylphosphine, Purity: Min 97%, CAS: 360048-63-1, Molecular Formula: C42H56FeO2P2, Color: orange, Form: Powder, Size: 0.5g.
Catalog Number: 100204-576
Supplier: Strem Chemicals Inc
Image Unavailable-100209-828

360048-63-1

Description: (R)-(-)-1-{(S)-2-[Bis(3,5-dimethyl-4-methoxyphenyl)phosphino]ferrocenyl}ethyldicyclohexylphosphine, Purity: Min 97%, CAS: 360048-63-1, Molecular Formula: C42H56FeO2P2, Color: orange, Form: Powder, Size: 0.1g.
Catalog Number: 100209-828
Supplier: Strem Chemicals Inc
Image Unavailable-102999-378

MBP (4 - 14) 5 mg

Description: MBP (4 - 14), Sequence: QKRPSQRSKYL, Purity: HPLC greater than or equal to 95%, Molecular Weight: 1390.6, A substrate for Protein Kinase C, Apperance: White Powder, Storage: -20 deg C, Size: 5 mg
Catalog Number: 102999-378
Supplier: Anaspec Inc
Image Unavailable-103003-034

Autocamtide-2 [KKALRRQETVDAL] 5mg

Description: Autocamtide-2 [KKALRRQETVDAL], Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 1527.8, Sequence: (One-Letter Code) KKALRRQETVDAL, native peptide is a selective substrate for Ca2+/CaMK, Appearance: White powder, Storage: At -20 degree C, Size: 5mg
Catalog Number: 103003-034
Supplier: Anaspec Inc
Image Unavailable-103007-358

Beta - Amyloid (1 - 28) - Lys(Biotin) 0.5 mg

Description: Beta - Amyloid (1 - 28) - Lys(Biotin) - NH2, Human, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNK - K(Biotin) - NH2, Purity: HPLC >/= 95%, amino acids 1 to 28 fragment of the b-amyloid peptide biotinylated, Molecular Weight: 3616, Storage: -20 C, Size: 0.5 mg
Catalog Number: 103007-358
Supplier: Anaspec Inc
Image Unavailable-103003-032

KKALRRQETVDAL 1mg

Description: KKALRRQETVDAL, Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 1527.8, native peptide is a selective substrate for Ca2+/calmodulin-dependent protein kinase (CaMK). Used to design assays for CaMKs, Appearance: White powder, Storage: At -20 degree C, Size: 1mg
Catalog Number: 103003-032
Supplier: Anaspec Inc
1,025 - 1,040 of 485,990