Print…

You Searched For: Molecular+Bioproducts+Inc.


560,165  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"560165"

Rate These Search Results

Image Unavailable-103386-160

Protein G Polyclonal antibody 1g

Description: Protein G Polyclonal antibody, Host: Porcine, Species Reactivity: Swine, Isotype: IgG, Molecular weight: 160000, Extinction Coefficient: 1.36, pH: 7.4, Application: ELISA, Western Blot, Purity: IgG fraction, Form: Frozen liquid, Storage: -70 deg C, Size: 1g
Catalog Number: 103386-160
Supplier: Innovative Research Inc
Image Unavailable-103386-156

Protein G Polyclonal antibody 50MG

Description: Protein G Polyclonal antibody, Host: Sheep, Species Reactivity: Sheep, Isotype: IgG, Molecular weight: 160000, Extinction Coefficient: 1.36, pH: 7.4, Application: ELISA, Western Blot, Purity: IgG fraction, Form: Frozen liquid, Storage: -70 deg C, Size: 50MG
Catalog Number: 103386-156
Supplier: Innovative Research Inc
Product Image-10128-486

Sodium Chloride 5M, sterile 10L

Catalog Number: 10128-486
Supplier: QUALITY BIOLOGICAL, INC.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Product Image-10128-492

Sodium Chloride, 5M 100ml

Catalog Number: 10128-492
Supplier: QUALITY BIOLOGICAL, INC.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Product Image-10128-490

Sodium Chloride, 5M, 4x100ml

Catalog Number: 10128-490
Supplier: QUALITY BIOLOGICAL, INC.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Product Image-10128-488

Sodium Chloride, 5M sterile 4L

Catalog Number: 10128-488
Supplier: QUALITY BIOLOGICAL, INC.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Product Image-10128-484

Sodium Chloride 5M 500ml

Catalog Number: 10128-484
Supplier: QUALITY BIOLOGICAL, INC.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Image Unavailable-103387-016

IgG1, Human Plasma 5mg

Description: IgG1, Human Plasma, Purity: >95% by SDS-PAGE analysis, Source: Human plasma, Molecular Weight: 150,000, Species: Human, Storage: -70 C, Form: Lyophilized powder, Preservative: Sodium Azide, Concentration: 1.0 mg/mlSample Volume 1.0 ml, Size: 5mg
Catalog Number: 103387-016
Supplier: Innovative Research Inc
Image Unavailable-103385-322

IgG1, Human Plasma 1mg

Description: IgG1, Human Plasma, Purity: >95% by SDS-PAGE analysis, Source: Human plasma, Molecular Weight: 150,000, Species: Human, Storage: -70 C, Form: Lyophilized powder, Preservative: Sodium Azide, Concentration: 1.0 mg/mlSample Volume 1.0 ml, Size: 1mg
Catalog Number: 103385-322
Supplier: Innovative Research Inc
Image Unavailable-103003-544

Beta - Amyloid (1 - 40) - Lys(Biotin - LC) 0.5 mg

Description: Beta - Amyloid (1 - 40) - Lys(Biotin - LC), Human, Purity: HPLC >/- 95%, Molecular Weight: 4797.5, Appearance: Lyophilized white powder, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K, contains a 6-carbon long chain, size: 0.5 mg
Catalog Number: 103003-544
Supplier: Anaspec Inc
Image Unavailable-103003-740

Sauvagine 0.5 mg

Description: Sauvagine, Purity: HPLC >/- 95%, Molecular Weight: 4599.4, Sequence: Pyr-GPPISIDLSLELLRKMIEIEKQEKEKQQAANNRLLLDTI-NH2, this peptide is a A hypotensive and diuretic peptide, Originally isolated from the skin of the frog, Phyllomedusa sauvagei, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 103003-740
Supplier: Anaspec Inc
Image Unavailable-103387-720

Prothrombin Polyclonal antibody 10ml

Description: Prothrombin Polyclonal antibody, Host: Sheep, Species: Mouse, Isotype: IgG, Molecular weight: 72KDa, Antigen: Full length native protein (purified) (Mouse), Application: ELISA, Western blot, Purity: Serum, Form: Frozen liquid, Storage: -70 deg C, Size: 10ml
Catalog Number: 103387-720
Supplier: Innovative Research Inc
Image Unavailable-103386-058

Prothrombin Polyclonal antibody 1ml

Description: Prothrombin Polyclonal antibody, Host: Sheep, Species: Mouse, Isotype: IgG, Molecular weight: 72KDa, Antigen: Full length native protein (purified) (Mouse), Application: ELISA, Western blot, Purity: Serum, Form: Frozen liquid, Storage: -70 deg C, Size: 1ml
Catalog Number: 103386-058
Supplier: Innovative Research Inc
Image Unavailable-102999-378

MBP (4 - 14) 5 mg

Description: MBP (4 - 14), Sequence: QKRPSQRSKYL, Purity: HPLC greater than or equal to 95%, Molecular Weight: 1390.6, A substrate for Protein Kinase C, Apperance: White Powder, Storage: -20 deg C, Size: 5 mg
Catalog Number: 102999-378
Supplier: Anaspec Inc
Image Unavailable-103007-416

Pyrrhocoricin 1 mg

Description: Pyrrhocoricin, Sequence: VDKGSYLPRPTPPRPIYNRN, Purity: By HPLC greater than or equal to 95%, proline-rich cationic antibacterial peptide pyrrhocoricin kills responsive bacteria, Molecular Weight: 2340.7, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-416
Supplier: Anaspec Inc
Image Unavailable-103007-602

[Arg6]-beta-Amyloid (1-40) English Mutation 0.5 mg

Description: [Arg6]-beta-Amyloid (1-40), English Mutation, Sequence: DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, Purity: By HPLC greater than or equal to 95%, Molecular Weight: 4348.9, Apperance: Powder, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 103007-602
Supplier: Anaspec Inc
1,009 - 1,024 of 560,165