Print…

You Searched For: Molecular+Bioproducts+Inc.


485,990  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"485990"

Rate These Search Results

Image Unavailable-103385-304

IgA, Human Plasma 5mg

Description: IgA, Human Plasma, Purity: >95% by SDS-PAGE analysis, Source: Human plasma, Molecular Weight: 170,000, Species: Human, Storage: -70 C, Form: Frozen liquid, Buffer: 0.1M Tris-HCl; 0.1M NaCl; pH 8.0, Concentration: 1.0 mg/ml, Size: 5mg
Catalog Number: 103385-304
Supplier: Innovative Research Inc
Image Unavailable-103386-006

Factor IX Polyclonal antibody 1mg

Description: Factor IX Polyclonal antibody, Host: Sheep, Species: Mouse, Isotype: IgG, Molecular weight: 56 KDa, Conjugate: FITC, Antigen: Full length native protein (purified) (Mouse), Application: ELISA, Western blot, Purity: Serum, Storage: -70 deg C, Size: 1mg
Catalog Number: 103386-006
Supplier: Innovative Research Inc
Image Unavailable-103388-226

TPA Polyclonal antibody 1ml

Description: TPA Polyclonal antibody, Host: Sheep, Species: Human, Isotype: IgG, Molecular weight: 70 Kda, Antigen: Recombinant full length wild-type human protein (Glycosylated), Application: ELISA, Western blot, Purity: Serum, Form: Frozen liquid, Storage: -70 deg C, Size: 1ml
Catalog Number: 103388-226
Supplier: Innovative Research Inc
Image Unavailable-103386-096

UPA Polyclonal antibody 1ml

Description: UPA Polyclonal antibody, Host: Sheep, Species: Mouse, Isotype: IgG, Molecular Weight: 44 Kda, Antigen: Recombinant full length wild-type mouse protein (Glycosylated), Application: ELISA, Western blot, Purity: Serum, Form: Frozen liquid, Storage: -70 deg C, Size: 1ml
Catalog Number: 103386-096
Supplier: Innovative Research Inc
Image Unavailable-103387-668

TPA Polyclonal antibody 10ml

Description: TPA Polyclonal antibody, Host: Sheep, Species: Human, Isotype: IgG, Molecular weight: 70 Kda, Antigen: Recombinant full length wild-type human protein (Glycosylated), Application: ELISA, Western blot, Purity: Serum, Form: Frozen liquid, Storage: -70 deg C, Size: 10ml
Catalog Number: 103387-668
Supplier: Innovative Research Inc
Image Unavailable-103387-758

UPA Polyclonal antibody 10ml

Description: UPA Polyclonal antibody, Host: Sheep, Species: Mouse, Isotype: IgG, Molecular Weight: 44 Kda, Antigen: Recombinant full length wild-type mouse protein (Glycosylated), Application: ELISA, Western blot, Purity: Serum, Form: Frozen liquid, Storage: -70 deg C, Size: 10ml
Catalog Number: 103387-758
Supplier: Innovative Research Inc
Image Unavailable-103385-300

IgG, Human Plasma 50mg

Description: IgG, Human Plasma, Purity: IgG fraction, Source: Human plasma, Molecular Weight: 160,000, Species: Human, Storage: -70 C, Form: Frozen liquid, Buffer: 0.02M Sodium Phosphate; 0.15M NaCl; pH 7.2, Concentration: 10 mg/ml, Applications: ELISA, Western Blot, Size: 50mg
Catalog Number: 103385-300
Supplier: Innovative Research Inc
Image Unavailable-103386-994

IgG, Human Plasma 1000mg

Description: IgG, Human Plasma, Purity: IgG fraction, Source: Human plasma, Molecular Weight: 160,000, Species: Human, Storage: -70 C, Form: Frozen liquid, Buffer: 0.02M Sodium Phosphate; 0.15M NaCl; pH 7.2, Concentration: 10 mg/ml, Applications: ELISA, Western Blot, Size: 1000mg
Catalog Number: 103386-994
Supplier: Innovative Research Inc
Image Unavailable-103006-418

TAT (47-57) FAM-labeled 1 mg

Description: TAT (47-57), FAM-labeled fluorescent, Absorbance /Em = 494/521 nm, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): FAM-YGRKKRRQRRR, Molecular Weight: 1918.2, Physical State: Solid, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-418
Supplier: Anaspec Inc
Image Unavailable-103003-544

Beta - Amyloid (1 - 40) - Lys(Biotin - LC) 0.5 mg

Description: Beta - Amyloid (1 - 40) - Lys(Biotin - LC), Human, Purity: HPLC >/- 95%, Molecular Weight: 4797.5, Appearance: Lyophilized white powder, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K, contains a 6-carbon long chain, size: 0.5 mg
Catalog Number: 103003-544
Supplier: Anaspec Inc
Image Unavailable-103007-358

Beta - Amyloid (1 - 28) - Lys(Biotin) 0.5 mg

Description: Beta - Amyloid (1 - 28) - Lys(Biotin) - NH2, Human, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNK - K(Biotin) - NH2, Purity: HPLC >/= 95%, amino acids 1 to 28 fragment of the b-amyloid peptide biotinylated, Molecular Weight: 3616, Storage: -20 C, Size: 0.5 mg
Catalog Number: 103007-358
Supplier: Anaspec Inc
Image Unavailable-103051-758

Dehydroascorbic acid 25g

Description: Dehydroascorbic acid, CAS: 490-83-5, Molecular Formula: C6H6O6, Molecular weight: 174.11 g/mol, Synonyms: Oxidized vitamin C; Dehydro-L-ascorbic acid; L-Ascorbic acid oxidized, Application: Dehydroascorbic acid is used as Vitamin COxidized form of vitamin C, Size: 25G
Catalog Number: 103051-758
Supplier: Biosynth International Inc

SDS


Image Unavailable-103051-664

Dehydroascorbic acid 50g

Description: Dehydroascorbic acid, CAS: 490-83-5, Molecular Formula: C6H6O6, Molecular weight: 174.11 g/mol, Synonyms: Oxidized vitamin C; Dehydro-L-ascorbic acid; L-Ascorbic acid oxidized, Application: Dehydroascorbic acid is used as Vitamin COxidized form of vitamin C, Size: 50G
Catalog Number: 103051-664
Supplier: Biosynth International Inc

SDS


Image Unavailable-100206-698

123333-45-9

Description: [P,P'-1,3-bis(di-i-propylphosphino)propane][P-1,3-bis(di-i-propylphosphino)propane]palladium (0),purity: Min 98%, CAS number: 123333-45-9, molecular Formula: C30H68P4Pd, Color: yellow, Form: oil to solid, Size: 1g
Catalog Number: 100206-698
Supplier: Strem Chemicals Inc
Image Unavailable-103385-298

IgG, Fc Fragment, Human Plasma 5mg

Description: IgG, Fc Fragment, Human Plasma, Purity: >95% by SDS-PAGE analysis, Source: Human plasma, Molecular Weight: 31,000, Species: Human, Storage: -70 C, Form: Frozen liquid, Preservative: Sodium Azide, Concentration: 1.0 mg/ml, Size: 5mg
Catalog Number: 103385-298
Supplier: Innovative Research Inc
Image Unavailable-103386-992

IgG, Fc Fragment, Human Plasma 10mg

Description: IgG, Fc Fragment, Human Plasma, Purity: >95% by SDS-PAGE analysis, Source: Human plasma, Molecular Weight: 31,000, Species: Human, Storage: -70 C, Form: Frozen liquid, Preservative: Sodium Azide, Concentration: 1.0 mg/ml, Size: 10mg
Catalog Number: 103386-992
Supplier: Innovative Research Inc
977 - 992 of 485,990