You Searched For: 4-Amino-3-chloropyridine


613,172  results were found

SearchResultCount:"613172"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (103386-058)
Supplier: Innovative Research Inc
Description: Prothrombin Polyclonal antibody, Host: Sheep, Species: Mouse, Isotype: IgG, Molecular weight: 72KDa, Antigen: Full length native protein (purified) (Mouse), Application: ELISA, Western blot, Purity: Serum, Form: Frozen liquid, Storage: -70 deg C, Size: 1ml


Catalog Number: (103387-720)
Supplier: Innovative Research Inc
Description: Prothrombin Polyclonal antibody, Host: Sheep, Species: Mouse, Isotype: IgG, Molecular weight: 72KDa, Antigen: Full length native protein (purified) (Mouse), Application: ELISA, Western blot, Purity: Serum, Form: Frozen liquid, Storage: -70 deg C, Size: 10ml


Catalog Number: (102999-854)
Supplier: Anaspec Inc
Description: Beta - Amyloid (1 - 43), Human, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4615.2, Solid AB (1-43) fibril is the most fibrillogenic of all the AB peptides, Apperance: Powder, Size: 1 mg


Catalog Number: (102999-852)
Supplier: Anaspec Inc
Description: Beta - Amyloid (1 - 43), Human, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT, Purity: HPLC >/- 95%, Molecular Weight: 4615.2, Solid AB (1-43) fibril is the most fibrillogenic of all the AB peptides, Apperance: Powder, Storage: -20 C, Size: 0.5 mg


Catalog Number: (76481-842)
Supplier: AAT BIOQUEST INC
Description: 6-TAMRA CPG 1000 /Aring;, The light-absorbing properties of TAMRA, and spectral overlap with several commonly used fluorophores - including FAM, HEX, TET and JOE, make it useful as a FRET acceptor for the dual labeled FRET probes such as Molecular Beacons, Size: 1g

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Catalog Number: (103000-896)
Supplier: Anaspec Inc
Description: Beta - Amyloid (2 - 42), Human, Purity: Peak Area By HPLC Greater than or equal to 95%, Molecular Weight: 4399, Sequence: AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg


Catalog Number: (76482-950)
Supplier: AAT BIOQUEST INC
Description: Strandbrite/Trade G 17656, STRANDBRITE/TRADE G 17656

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Catalog Number: (102995-174)
Supplier: Strem Chemicals Inc
Description: (4R)-4-i-Propyl-1,2,3-oxathiazolidine-2,2-dioxide-3-carboxylic acid t-butyl ester, minimum 97%, Molecular Formula: C10H19NO5S, Color and Form: white solid, Formula Weight: 265.33, Size: 1kg


Catalog Number: (101175-326)
Supplier: Thermo Fisher Scientific Chemicals Inc.
Description: 500 gm


Catalog Number: (103007-600)
Supplier: Anaspec Inc
Description: [Asn7]-beta-Amyloid (1-40), Tottori-Japanese Mutation, Sequence: DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, Purity: By HPLC greater than or equal to 95%, Molecular Weight: 4328.9, Apperance: Powder, Storage: -20 deg C, Size: 0.5 mg


Catalog Number: (103007-672)
Supplier: Anaspec Inc
Description: Cys-LC-LL-37, Sequence: C-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES, Purity: By HPLC greater than or equal to 95%, Molecular Weight: 4709.7, Storage: -20 deg C, Size: 1 mg


Catalog Number: (76482-948)
Supplier: AAT BIOQUEST INC
Description: Strandbrite/Trade G 17655, STRANDBRITE/TRADE G 17655

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Catalog Number: (103387-604)
Supplier: Innovative Research Inc
Description: Plasminogen Polyclonal antibody, Host: Sheep, Species: Human, Isotype: IgG, Molecular weight: 92 Kda, Antigen: Full length native protein (purified) (Human), Application: ELISA, Western blot, Purity: Serum, Form: Frozen liquid, Storage: -70 deg C, Size: 10ml


Catalog Number: (103385-418)
Supplier: Innovative Research Inc
Description: Factor VII Monoclonal antibody, Clone: 9031, Host: Rat, Species: Mouse, Target Molecular weight: 50 KDa, Antigen: Full length native protein (purified) (Mouse), Application: ELISA, Western Blot, Purity: IgG fraction, Storage: -20 deg C, Size: 0.1mg


Catalog Number: (103388-108)
Supplier: Innovative Research Inc
Description: Factor X Monoclonal antibody, Clone: 9051, Host: Rat, Species: Mouse, Target Molecular weight: 58900, Antigen: Full length native protein (purified) (Mouse), Application: ELISA, Western Blot, Purity: IgG fraction, Form: Liquid, Storage: -20 deg C, Size: 0.1mg


Catalog Number: (103385-918)
Supplier: Innovative Research Inc
Description: Plasminogen Polyclonal antibody, Host: Sheep, Species: Human, Isotype: IgG, Molecular weight: 92 Kda, Antigen: Full length native protein (purified) (Human), Application: ELISA, Western blot, Purity: Serum, Form: Frozen liquid, Storage: -70 deg C, Size: 1ml


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1 - 16 of 613,172
no targeter for Bottom