You Searched For: C646


613,172  results were found

SearchResultCount:"613172"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (103003-294)
Supplier: Anaspec Inc
Description: N-(Biotinoyl)-N''-(iodoacetyl)ethylenediamine, Molecular Weight: 454.3, Appearance: solid, Solvent System: DMSO or DMF, Thiol-reactive biotinylating reagent for proteins and other biomolecules, Storage: -20 deg C, Size: 25 mg


Catalog Number: (103006-506)
Supplier: Anaspec Inc
Description: Beta-Amyloid (1-40)-Lys(Biotin)-NH2, Human, Purity: HPLC >/=95%, Sequence (One-Letter Code): DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2, Molecular weight: 4683.4, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 0.5 mg


Catalog Number: (103006-280)
Supplier: Anaspec Inc
Description: Influenza NP (147 - 155) (TYQRTRALV), Sequence (Three-Letter Code): H - Thr - Tyr - Gln - Arg - Thr - Arg - Ala - Leu - Val - OH, Molecular Weight: 1107.3, Physical State: Powder, Storage: -20 degree C, Size: 1 mg


Catalog Number: (102996-430)
Supplier: Anaspec Inc
Description: H-Gly-Pro-AMC, Purity: HPLC >/= 95%, Molecular Weight: 329.2, Sequence: H-Gly-Pro-AMC, Appearance: Powder, This is a fluorescent dipeptidylaminopeptidase IV substrate, Abs/Em=353/442 nm, Storage: -20 deg C, Size: 10 mg


Catalog Number: (103007-750)
Supplier: Anaspec Inc
Description: gp91 ds-tat, sgp91 ds-tat, scrambled, Sequence: YGRKKRRQRRRCLRITRQSR-NH2, Purity: By HPLC greater than or equal to 95%, This is a control peptide for gp91 ds-tat, Molecular Weight: 2673.2, Apperance: powder, Storage: -20 deg C, Size: 1 mg


Catalog Number: (103000-710)
Supplier: Anaspec Inc
Description: CEF20, Cytomegalovirus, CMV pp65 (495 - 503), HLA-A*0201-restricted epitope from Cytomegalovirus pp65 (495-503), Molecular Weight: 943.2, Sequence: NLVPMVATV, Physical State: Solid, Store away from oxidizing agent. Storage: -20 deg C, Size: 1 mg


Catalog Number: (103011-378)
Supplier: Anaspec Inc
Description: BSB, Synonym: (trans,trans) - 1 - Bromo-2,5-bis-(3-hydroxycarbonyl-4-hydroxy)styrylbenzene, Molecular Weight: 481.3, Spectral Properties: Abs/Em = 340/520 nm, Solvent System: DMSO, CAS Number: 56776-28-4, Appearance: powder, derived from the structure of Congo Red, Size: 5 mg


Catalog Number: (103007-600)
Supplier: Anaspec Inc
Description: [Asn7]-beta-Amyloid (1-40), Tottori-Japanese Mutation, Sequence: DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, Purity: By HPLC greater than or equal to 95%, Molecular Weight: 4328.9, Apperance: Powder, Storage: -20 deg C, Size: 0.5 mg


Catalog Number: (76485-822)
Supplier: AAT BIOQUEST INC
Description: Cell Meter/Trade Li 23015, Adenosine triphosphate (ATP) plays a fundamental role in cellular energetics, metabolic regulation / cellular signaling. It is referred as "molecular unit of currency" of intracellular energy transfer to drive many biological processes / chemical synthesis in living cells.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Catalog Number: (103003-180)
Supplier: Anaspec Inc
Description: Beta-Amyloid (1-40), Purity: HPLC >/- 95%, Molecular Weight: 5199, Sequence: HiLyte* Fluor 555-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, label: HiLyte Fluor* 555, Appearance: Lyophilized red powder, this is a fluorescent labeled B-Amyloid peptide, Size: 0.1 mg


Catalog Number: (103006-916)
Supplier: Anaspec Inc
Description: Histone H3 ( amino acids 116-136), C116-136, spans the C-terminus of histone H3, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): KRVTIMPKDIQLARRIRGERA, Molecular Weight: 2508, Storage: -20 degree C, Size: 1 mg


Catalog Number: (103003-372)
Supplier: Anaspec Inc
Description: HNP-2, Defensin Human Neutrophil Peptide-2, Purity: HPLC >/- 95%, Molecular Weight: 3371, Sequence: CYCRIPACIAGERRYGTCIYQGRLWAFCC, HNP-2 is a 29-residue peptide present in human neutrophils and is a member of the defensin family of antimicrobial peptides, Size: 0.1 mg


Catalog Number: (76303-884)
Supplier: PeproTech, Inc.
Description: MIDKINE Recombinant, Purity: > 98% by SDS-PAGE gel and HPLC, Source: E.coli, Reactivity: Human, Molecular mass of 13.4 kDa protein containing 123 aa residues including five intra-molecular disulfide bonds, Synonyms: MK, NEGF-2, Size: 50 uG


Catalog Number: (76483-414)
Supplier: AAT BIOQUEST INC
Description: Oxivision/Trade Gre 21505 1Mg, Despite the importance of H2O2 to human health and disease, the molecular mechanisms of its production, accumulation, trafficking, and function insufficiently understood due to the lack of sensitive and specific H2O2 sensors that can be used in live cells, Size: 1mg

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Catalog Number: (103371-824)
Supplier: Biosynth International Inc
Description: Bis(trifluoromethane)sulfonimide lithium salt, CAS Number: 90076-65-6, Molecular Formula: C2F6LiNO4S2, Molecular weight: 287.09 g/mol, Color: white to off-white, Form: crystalline powder, Storage: room temperature, size: 0.5KG

SDS


Catalog Number: (103371-828)
Supplier: Biosynth International Inc
Description: Bis(trifluoromethane)sulfonimide lithium salt, CAS Number: 90076-65-6, Molecular Formula: C2F6LiNO4S2, Molecular weight: 287.09 g/mol, Color: white to off-white, Form: crystalline powder, Storage: room temperature, size: 2.5KG

SDS


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
-47 - -32 of 613,172
no targeter for Bottom