Print…

You Searched For: Molecular+Bioproducts+Inc.


377,217  results were found

Refine Results Sort by
SearchResultCount:"377217"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-103013-868

Human Recombinant Transthyretin (from HEK293 Cells)

Supplier: ACROBIOSYSTEMS
Description: Transthyretin/Prealbumin Protein, Host: HEK293 cells, Species Reactivity: Human, Purity: >95% (SDS-PAGE), Molecular Characterization: His Tag fused with polyhistidine tag at C-terminus, MW 14.6KDa, Synonyms: Transthyretin,CTS1, Size: 100ug

Image Unavailable-103012-750

Mouse Recombinant Dkk-1 (from HEK293 Cells)

Supplier: ACROBIOSYSTEMS
Description: Mouse Dkk-1 Protein, Host: HEK293 cells, Species Reactivity: mouse, purity: >95% SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at the C-terminus, MW of 28 kDa, Synonym: DKK1,SK, Storage: 4 Degree C, size: 50ug

Image Unavailable-103014-904

Human Recombinant LILRB2 (from HEK293 Cells)

Supplier: ACROBIOSYSTEMS
Description: LILRB2 / CD85d / ILT4 Protein, Host: HEK293 Cells, Species Reactivity: Human, purity: >92%, Molecular Characterization: polyhistidine tag at the C-terminus, MW of 48.6 kDa, Synonym: LILRB2, ILT4, LIR2, MIR10, CD85d, Storage: 4 deg C, Size: 100UG

Image Unavailable-103012-762

Mouse Recombinant Dkk-3 (from HEK293 Cells)

Supplier: ACROBIOSYSTEMS
Description: Mouse Dkk-3 Protein, Host: HEK293 cells, Species Reactivity: mouse, purity: >95% SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at the C-terminus, MW of 37.1 kDa, Synonym: DKK3,REIC,RIG, Storage: 4 Degree C, size: 1mg

Image Unavailable-103012-900

Human Recombinant Erythropoietin (from HEK293 cells)

Catalog Number: (103012-900)
Supplier: ACROBIOSYSTEMS
Description: ActiveMax* Recombinant Erythropoietin/EPO, Host: HEK293 Cells, Species: Human, Purity: >97% by SDS-PAGE, Molecular Characterization: Tag free, MW 18.4 kDa, Synonym: EPO, EP, MVCD2, Erythropoietin, Erythropoetin, Erthropoyetin, Size: 50ug
Image Unavailable-103012-690

Human Recombinant Cystatin D (from HEK293 Cells)

Supplier: ACROBIOSYSTEMS
Description: Human Cystatin D/Cst10 Protein, Host: HEK293 cells, Species Reactivity: Human, purity: >95% SDS-PAGE, Molecular Characterization: fused with 6xHis tag at the C-terminus, MW of 14.7 kDa, Synonym: CST5, Cystatin-5, Cystatin-D, Storage: 4 Degree C, size: 50ug

Image Unavailable-103015-460

Human Recombinant Stathmin 1 (from E. coli)

Supplier: ACROBIOSYSTEMS
Description: Stathmin 1/STMN1 Protein, Host: E.coli, Species Reactivity: Human, Purity: >92% by SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at the N-terminus, MW of 18.1 kDa, Synonym: STMN1,Stathmin,C1orf215,LAP18,OP18, Storage: 4 deg C, Size: 100ug

Image Unavailable-103014-014

Ebolavirus Recombinant Glycoprotein / GP (virus) (from HEK293 cells)

Supplier: ACROBIOSYSTEMS
Description: Recombinant BDBV(subtype Bundibugyo,strain Uganda 2007) Small/secreted Glycoprotein(sGP), Host: HEK293 cells, Species: Ebolavirus, Purity: >95%(SDS-PAGE), Molecular Characterization: Polyhistidine tag at C-terminus, Synonym: Ebola sGP, Size: 50ug

Image Unavailable-103012-476

Human Recombinant CD98 (from HEK293 Cells)

Supplier: ACROBIOSYSTEMS
Description: Human CD98 Protein, Host: HEK293 cells, Species Reactivity: Human, purity: >95% SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at the C-terminus, MW of 47.7 kDa, Synonym: SLC3A2,CD98,4F2,4F2HC,4T2HC, Storage: 4 Degree C, size: 1mg

Image Unavailable-103013-970

Human Recombinant VEGF-D (from HEK293 Cells)

Catalog Number: (103013-970)
Supplier: ACROBIOSYSTEMS
Description: VEGF-D Protein, Host: HEK293 cells, Species Reactivity: Human, Purity: >95% (SDS-PAGE), Molecular Characterization: His Tag is fused with a polyhistidine tag at the C-terminus, with calculated MW of of 13 KDa, Synonyms: FIGF,VEGFD, Storage: 4 degree C, Size: 1mg
Image Unavailable-103014-248

Human Recombinant CEACAM-1 (from HEK293 Cells)

Supplier: ACROBIOSYSTEMS
Description: CEACAM-1 / CD66a Protein, Host: HEK293 Cell, Species Reactivity: Human, Purity: >92%, Molecular Characterization: His Tag is fused with a polyhistidine tag, MW of 44.2 kDa, Synonym: CEACAM1,CD66a,BGP,BGP1,BGPI, Storage: 4 deg C, Size: 1MG

Image Unavailable-103815-258

Mouse Recombinant CD47 (from HEK293 cells), Biotin

Supplier: ACROBIOSYSTEMS
Description: Biotinylated Mouse CD47 Protein, His,Avitag™, ACROBiosystems

Image Unavailable-103014-868

Human Recombinant Lipopolysaccharide-binding protein / LBP (from HEK293 Cells)

Supplier: ACROBIOSYSTEMS
Description: LBP /Lipopolysaccharide Protein, Host: HEK293 Cells, Species Reactivity: Human, purity: >95%, Molecular Characterization: MW of 52.8 kDa, Synonym: Lambda Chain Binding Protein,Lambda Binding Protein,LBP, Storage: 4 deg C, Size: 100UG

Image Unavailable-103013-806

Human Recombinant Osteoprotegerin (from HEK293 Cells)

Supplier: ACROBIOSYSTEMS
Description: Osteoprotegerin/TNFRSF11B Protein, Host: HEK293 cells, Species Reactivity: Human, Purity: >95%(SDS-PAGE), Molecular Characterization: His Tag fused with polyhistidine tag at C-terminus, MW 44.4KDa, Synonyms: TNFRSF11B,OCIF, Storage: 4 deg C, Size: 100ug

Image Unavailable-102998-450

Human Calcitonin Peptide

Supplier: Anaspec Inc
Description: Human calcitonin reduces blood calcium, opposing the effects of parathyroid hormone (PTH). It stimulates cyclic nucleotide accumulation in human kidney cortex and medulla. Calcitonin maybe involved in osteoporosis and in Paget's disease.
Sequence: CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge: 1-7)
MW: 3417.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Image Unavailable-103007-536

Human Leptin (93-105)

Catalog Number: (103007-536)
Supplier: Anaspec Inc
Description: This is amino acids 93 to 105 fragment of human leptin (anti-obesity protein). Leptin is a 167-amino acid plasma protein that is synthesized in adipose tissue and acts as a blood-borne hormone responsible for weight maintenance.
Sequence: NVIQISNDLENLR
MW: 1527.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
865 - 880 of 377,217
no targeter for Bottom