Print…

You Searched For: Molecular+Bioproducts+Inc.


485,990  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"485990"

Rate These Search Results

Image Unavailable-103007-584

Beta-Amyloid (1-12) Human 1 mg

Description: Beta-Amyloid (1-12), Human, Sequence: DAEFRHDSGYEV, Purity: By HPLC greater than or equal to 95%, This is amino acids 1 to 12 fragment of the beta-amyloid peptide, Molecular Weight: 1424.5, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-584
Supplier: Anaspec Inc
Image Unavailable-103387-024

IgG3, Human Plasma 5mg

Description: IgG3, Human Plasma, Purity: >95% by SDS-PAGE analysis, Source: Human plasma, Molecular Weight: 170,000, Species: Human, Storage: 4 C, Form: Liquid, DO NOT FREEZE, Preservative: Sodium Azide, Concentration: 1.0 mg/ml, Size: 5mg
Catalog Number: 103387-024
Supplier: Innovative Research Inc
Image Unavailable-103385-330

IgG3, Human Plasma 1mg

Description: IgG3, Human Plasma, Purity: >95% by SDS-PAGE analysis, Source: Human plasma, Molecular Weight: 170,000, Species: Human, Storage: 4 C, Form: Liquid, DO NOT FREEZE, Preservative: Sodium Azide, Concentration: 1.0 mg/ml, Size: 1mg
Catalog Number: 103385-330
Supplier: Innovative Research Inc
Image Unavailable-103007-164

HCAM - 2 1 mg

Description: HCAM - 2, Sequence: 6 - FAM - VFDAVTDVIIKNNLKECGLY, A pertussis toxin (PTx) enzyme substrate that is labeled with 6-FAM (6-carboxyfluorescein), Abs/Em=494 nm/521 nm, Molecular Weight: 2613, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-164
Supplier: Anaspec Inc
Image Unavailable-103006-280

Influenza NP (147 - 155) (TYQRTRALV) 1 mg

Description: Influenza NP (147 - 155) (TYQRTRALV), Sequence (Three-Letter Code): H - Thr - Tyr - Gln - Arg - Thr - Arg - Ala - Leu - Val - OH, Molecular Weight: 1107.3, Physical State: Powder, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-280
Supplier: Anaspec Inc
Image Unavailable-102996-430

H-Gly-Pro-AMC 10 mg

Description: H-Gly-Pro-AMC, Purity: HPLC >/= 95%, Molecular Weight: 329.2, Sequence: H-Gly-Pro-AMC, Appearance: Powder, This is a fluorescent dipeptidylaminopeptidase IV substrate, Abs/Em=353/442 nm, Storage: -20 deg C, Size: 10 mg
Catalog Number: 102996-430
Supplier: Anaspec Inc
Image Unavailable-103007-750

gp91 ds-tat, sgp91 ds-tat scrambled 1 mg

Description: gp91 ds-tat, sgp91 ds-tat, scrambled, Sequence: YGRKKRRQRRRCLRITRQSR-NH2, Purity: By HPLC greater than or equal to 95%, This is a control peptide for gp91 ds-tat, Molecular Weight: 2673.2, Apperance: powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-750
Supplier: Anaspec Inc
Image Unavailable-103000-710

CEF20, Cytomegalovirus, CMV pp65 (495 - 503) 1 mg

Description: CEF20, Cytomegalovirus, CMV pp65 (495 - 503), HLA-A*0201-restricted epitope from Cytomegalovirus pp65 (495-503), Molecular Weight: 943.2, Sequence: NLVPMVATV, Physical State: Solid, Store away from oxidizing agent. Storage: -20 deg C, Size: 1 mg
Catalog Number: 103000-710
Supplier: Anaspec Inc
Image Unavailable-103011-368

TMRE 25 mg

Description: TMRE, Synonym: Tetramethylrhodamine, ethyl ester, perchlorate, for measuring membrane potential of mitochondria; Fluorescence is less dependent on dye location, Molecular Weight: 514.96, Spectral Properties: Abs/Em = 549/574 nm, Solvent System: DMSO, CAS: 115532-52-0, Size: 25 mg
Catalog Number: 103011-368
Supplier: Anaspec Inc
Image Unavailable-103000-892

Beta - Amyloid (4 - 42), Human 1 mg

Description: Beta - Amyloid (4 - 42), Human, Purity: Peak Area By HPLC Greater than or equal to 95%, Molecular Weight: 4198.8, Sequence: FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103000-892
Supplier: Anaspec Inc
Image Unavailable-102999-806

Scrambled - beta - Amyloid (1 - 40) 1 mg

Description: Scrambled - beta - Amyloid (1 - 40), human, Sequence: AEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4329.9, Apperance: Lyophilized white powder, freely soluble in basic buffer, Size: 1 mg
Catalog Number: 102999-806
Supplier: Anaspec Inc
Image Unavailable-76484-788

Phosphoworks/Trade 21620, Adenosine triphosphate (ATP) plays a fundamental role in cellular energetics, metabolic regulation and cellular signaling. It is referred as the \"molecular unit of currency\" of intracellular energy transfer to drive many processes and chemical synthesis in living cells.

Description: Phosphoworks/Trade 21620, Adenosine triphosphate (ATP) plays a fundamental role in cellular energetics, metabolic regulation and cellular signaling. It is referred as the \"molecular unit of currency\" of intracellular energy transfer to drive many processes and chemical synthesis in living cells.
Catalog Number: 76484-788
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Image Unavailable-102996-230

Neuropeptide Y 0.5 mg

Description: Neuropeptide Y, human, rat, Purity: HPLC >/= to 95%, Molecular Weight: 4271.8, Sequence: YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102996-230
Supplier: Anaspec Inc
Image Unavailable-103010-842

6 - TAMRA, Special Formulation 100 mg

Description: 6 - TAMRA, Special Formulation, purified single isomer, Synonym: 6-Carboxytetramethylrhodamine, Molecular Weight: 430.45 (Free Acid), Spectral Properties: Abs/Em = 541/568 nm, Solvent System: DMF or DMSO, Storage -20 degree C, Size: 100 mg
Catalog Number: 103010-842
Supplier: Anaspec Inc
Product Image-10128-558

Calcium Chloride 2M, clear colourless liquid, 100ml

Catalog Number: 10128-558
Supplier: QUALITY BIOLOGICAL, INC.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Product Image-10128-556

Calcium Chloride 2M, clear colourless liquid, 4x100ml

Catalog Number: 10128-556
Supplier: QUALITY BIOLOGICAL, INC.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


849 - 864 of 485,990