Print…

You Searched For: (3,4-Dichloro-5-methoxyphenyl)boronic+acid


377,217  results were found

Refine Results Sort by
SearchResultCount:"377217"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-103011-026

Fluorescein-5-thiosemicarbazide

Catalog Number: (103011-026)
Supplier: Anaspec Inc
Description: 5-FTSC reacts with ketones to yield relatively stable hydrazones and with aldehydes to yield hydrazones that are somewhat less stable, though they may be formed faster (compared to ketones). These hydrazones are generally reduced with sodium borohydride (NaBH4) to further increase the stability of the linkage. 5-FTSC has been used to make a wide variety of biomolecules such as L-aspartase-a-decarboxylase, enzyme-oxidized live plant protoplasts, immunoglobulins, thrombin and antithrombin.
Image Unavailable-103008-446

Chicken OVA (329-337)

Catalog Number: (103008-446)
Supplier: Anaspec Inc
Description: This sequence is OVA (ovalbumin) peptide residues 257 to 280, also known as OT-II (OVA-specific T-cell receptor) peptide, the core H2b-restricted class II MHC epitope.
Sequence: AAHAEINEA
MW: 925 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Image Unavailable-103015-008

Human Recombinant MMP9 (from HEK293 Cells)

Supplier: ACROBIOSYSTEMS
Description: MMP-9 Protein, Host: HEK293 Cells, Species Reactivity: Human, purity: >95%, Molecular Characterization: polyhistidine tag at the C-terminus, MW of 50.8 kDa, Endotoxin: Less than 1.0 EU per ug, Synonym: MMP9,CLG4B,GELB,MANDP2,Gelatinase B, Storage: 4 deg C, Size: 1MG

Image Unavailable-103007-756

Histone H3 (1-21), FAM (Carboxyfluorescein)

Catalog Number: (103007-756)
Supplier: Anaspec Inc
Description: This sequence corresponds to the first 21 amino acids of the NH2 terminal of histone H3 followed by a GG linker and a FAM (Abs/Em = 494/521 nm) labeled lysine.
Sequence:ARTKQTARKSTGGKAPRKQLA-GGK(FAM)-NH2
MW:2854.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-102996-480

Human Beta-Amyloid (12-28)

Supplier: Anaspec Inc
Description: Aß (12–28) residues are the binding site for apolipoprotein E (apoE) on Aß. This sequence encompasses a hydrophobic domain (residues 14–21) and a ß-turn (residues 22–28) which place two hydrophobic domains of Aß 14 to 21 and 29 to 40/42 opposite each other, allowing for the assembly of Aß peptides into fibrils. The secondary structure of Aß (12- 28), a neutral peptide, is dominated by a-helix and random coil.
equence: VHHQKLVFFAEDVGSNK
Molecular Weight: 1955.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Image Unavailable-103006-272

Drosophila Antennapedia Peptide

Catalog Number: (103006-272)
Supplier: Anaspec Inc
Description: The Antennapedia homeodomain protein of Drosophila has the ability to penetrate biological membranes and the third helix of this protein, residues 43-58, known as penetratin (RQIKIWFQNRRMKWKK-amide) has the same translocating properties as the entire protein.
Sequence:C(Npys)-RQIKIWFQNRRMKWKK-NH2
MW:2505 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-194

C34, gp41 HIV Fragment

Catalog Number: (103007-194)
Supplier: Anaspec Inc
Description: This C34 peptide, also known as HR2, belongs to the helical region of gp41 of HIV, C-terminal heptad repeat 2 (HR2) defined as C helix or C peptide. It is known that HIV-1 enters cells by membrane fusion, C34 gp41 peptide is a potent inhibitors of HIV-1 fusion.
Sequence:WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL
MW:4248.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-786

HIV Gp91 TAT Peptide 2

Catalog Number: (103007-786)
Supplier: Anaspec Inc
Description: This peptide is a scrambled sequence of NADPH oxidase assembly peptide inhibitor gp91 ds-tat. It is used as a control peptide. It is two amino acid residues shorter at the N-terminus compared with the scrambled gp91 ds-tat.
Sequence: RKKRRQRRRCLRITRQSR-NH2
MW: 2453 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-102996-258

Human;Sheep;Rat PACAP (6-38), amide

Supplier: Anaspec Inc
Description: This peptide is a potent antagonist of PACAP 38 and is much more potent and selective than PACAP (6-27) in the inhibition of PACAP-27 stimulated pituitary adenylate cyclase. The Ki values for the inhibition of the enzyme are 7nM and 150 nM, respectively.
Sequence: FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
MW: 4024.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Image Unavailable-102998-432

Human ACTH (18-39)

Catalog Number: (102998-432)
Supplier: Anaspec Inc
Description: This ACTH (18-39) fragment is known as the Corticotropin-like Intermediate Lobe Peptide. It stimulates insulin secretion as well as amylase and protein secretion in a dose-dependent manner similar to those of secretin and carbamylcholine.
Sequence: RPVKVYPNGAEDESAEAFPLEF
MW: 2465.7 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Image Unavailable-103006-502

[Asp370]-Tyrosinase (368-376)

Catalog Number: (103006-502)
Supplier: Anaspec Inc
Description: This tumor antigenic peptide presented by HLA-A2 antigen to CTLs, is a tyrosinase fragment. Tyrosinase is a membrane-bound protein involved in the melanin synthesis pathway that is expressed by virtually all primary melanoma lesions and by most of metastatic lesions.
Sequence:YMDGTMSQV
MW:1031.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Product Image-10128-452

Water for molecular biology nuclease-, protease-free, low endotoxin, deionized, sterile

Supplier: QUALITY BIOLOGICAL, INC.
Description: Molecular Biology Water is prepared by reverse osmosis, passed through fine carbon, deionized through two resin beds, and serially filtered through 0.1 µm positively charged membranes.

Small Business Enterprise Minority or Woman-Owned Business Enterprise

Image Unavailable-103007-214

Human [Lys22]-beta-Amyloid (1-40)

Catalog Number: (103007-214)
Supplier: Anaspec Inc
Description: This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22, found in Italian families. The Italian mutation of beta-amyloid 1-40 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might be a reason why E22K-beta-amyloid 40 is more pathogenic than wild-type beta-amyloid 40.
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Product Image-470230-928

3B Scientific® Cell Anatomy Models Bundle

Catalog Number: (470230-928)
Supplier: VWR
Description: Modeled After EM Scans.
Image Unavailable-76303-960

Mouse Recombinant R-Spondin-1 (from CHO cells)

Catalog Number: (76303-960)
Supplier: PeproTech, Inc.
Description: R-Spondin-1 (Rspo-1) belongs to the (Rspo) family of Wnt modulators. Currently, the family consists of four structurally related secreted ligands (Rspo 1-4), all containing the furin-like and thrombospondin structural domains. Rspo-1 is expressed in certain areas of the developing central nervous system, as well as in the adrenal glands, ovary, testis, thyroid, and trachea. Rspo can interact with the Frizzled/LRP6 receptor complex in a manner that stimulates the Wnt/beta-catenin signaling pathway. Recombinant Murine R-Spondin-1 is a 27.1 kDa protein consisting of 245 amino acid residues. Due to glycosylation, R-Spondin-1 migrates at an apparent molecular weight of approximately 40.0 kDa by SDS-PAGE analysis under reducing conditions.
Image Unavailable-10773-960

Human Recombinant NP-1 (from E. coli)

Supplier: PeproTech, Inc.
Description: Defensins (alpha and beta) are cationic peptides with a broad spectrum of antimicrobial activity that comprise an important arm of the innate immune system. The α-defensins, which include NP-1, NP-2 and NP-3, are distinguished from the β-defensins by the pairing of their three disulfide bonds. In addition to antimicrobial activity, NP-1 exhibits chemotactic activity on dendritic cells. NP-1 is expressed as the C-terminal portion of an inactive precursor protein, which also contains a 19 amino acid N-terminal signal sequence and a 45 amino acid polypeptide. NP-1 contains a six-cysteine motif that forms three intra-molecular disulfide bonds. Recombinant Human NP-1 is a 3.4 kDa protein containing 30 amino acid residues.

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
641 - 656 of 377,217
no targeter for Bottom