Print…

You Searched For: Molecular+Bioproducts+Inc.


485,990  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"485990"

Rate These Search Results

Image Unavailable-103000-622

Beta-Amyloid (42-1), Human 1 mg

Description: Beta-Amyloid (42-1), Human, Sequence: AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD, Purity: Peak Area By HPLC greater than or equal to 95%, Molecular Weight: 4514.1, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103000-622
Supplier: Anaspec Inc
Image Unavailable-103000-624

Beta-Amyloid (42-1), Human 0.1 mg

Description: Beta-Amyloid (42-1), Human, Sequence: AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD, Purity: Peak Area By HPLC greater than or equal to 95%, Molecular Weight: 4514.1, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 0.1 mg
Catalog Number: 103000-624
Supplier: Anaspec Inc
Image Unavailable-76481-842

6-TAMRA CPG 1000 /Aring;, The light-absorbing properties of TAMRA, and spectral overlap with several commonly used fluorophores - including FAM, HEX, TET and JOE, make it useful as a FRET acceptor for the dual labeled FRET probes such as Molecular Beacons, Size: 1g

Description: 6-TAMRA CPG 1000 /Aring;, The light-absorbing properties of TAMRA, and spectral overlap with several commonly used fluorophores - including FAM, HEX, TET and JOE, make it useful as a FRET acceptor for the dual labeled FRET probes such as Molecular Beacons, Size: 1g
Catalog Number: 76481-842
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Product Image-76514-168

Tip, Expert, Filter, Tip Filter Material: Polyethylene, Tip Filter: Filtered, Material of Construction: Polypropylene, RNase, DNase free, significantly contribute to molecular testing performance by ensuring sample integrity during the pipetting process, Size: 100-1000ul

Description: Tip, Expert, Filter, Tip Filter Material: Polyethylene, Tip Filter: Filtered, Material of Construction: Polypropylene, RNase, DNase free, significantly contribute to molecular testing performance by ensuring sample integrity during the pipetting process, Size: 100-1000ul
Catalog Number: 76514-168
Supplier: GILSON, INC.
Product Image-76514-170

Tip, Expert, Filter, Tip Filter Material: Polyethylene, Tip Filter: Filtered, Material of Construction: Polypropylene, RNase, DNase free, significantly contribute to molecular testing performance by ensuring sample integrity during the pipetting process, Size: 10-200ul

Description: Tip, Expert, Filter, Tip Filter Material: Polyethylene, Tip Filter: Filtered, Material of Construction: Polypropylene, RNase, DNase free, significantly contribute to molecular testing performance by ensuring sample integrity during the pipetting process, Size: 10-200ul
Catalog Number: 76514-170
Supplier: GILSON, INC.
Image Unavailable-103003-052

Amylin (1 - 37) 1 mg

Description: Amylin (1 - 37), human, amide, Purity: HPLC >/- 95%, Molecular Weight: 3903.3, Sequence: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103003-052
Supplier: Anaspec Inc
Image Unavailable-103007-788

Tetradecapeptide Renin Substrate, Angiotensinogen (1-14), rat 1 mg

Description: Tetradecapeptide Renin Substrate, Angiotensinogen (1-14), rat, Purity: By HPLC >/= 95%, derived from rat angiotensinogen amino acid residues 1-14. It is a synthetic renin substrate, Molecular Weight: 1823.1, Size: 1 mg
Catalog Number: 103007-788
Supplier: Anaspec Inc
Image Unavailable-103007-108

Beta - Amyloid (1 - 40) - Lys(LC - biotin) - NH2 0.1 mg

Description: Beta - Amyloid (1 - 40) - Lys(LC - biotin) - NH2, FAM - labeled, Human, FABB, Purity: By HPLC greater than or equal to 95%, biotinylated on the lysine side chain, Molecular Weight: 5154.9, Storage: -20 deg C, Size: 0.1 mg
Catalog Number: 103007-108
Supplier: Anaspec Inc
Image Unavailable-102996-724

Scrambled-beta-Amyloid (1-42) 1 mg

Description: Scrambled-beta-Amyloid (1-42), Human, Purity: HPLC >/= 95%, Molecular Weight: 4514.1, Sequence: AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA, Appearance: White Powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 102996-724
Supplier: Anaspec Inc
Image Unavailable-103007-584

Beta-Amyloid (1-12) Human 1 mg

Description: Beta-Amyloid (1-12), Human, Sequence: DAEFRHDSGYEV, Purity: By HPLC greater than or equal to 95%, This is amino acids 1 to 12 fragment of the beta-amyloid peptide, Molecular Weight: 1424.5, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-584
Supplier: Anaspec Inc
Product Image-76480-514

Sulforhodamine 101, sodium salt, is a fluorescence reference standard for measuring fluorescence quantum yield. It is also the key precursor used for preparing rhodamine 101 sulfonyl chloride (also called Texas Red/reg;, a trademark of Molecular Probes), Size: 25mg

Description: Sulforhodamine 101, sodium salt, is a fluorescence reference standard for measuring fluorescence quantum yield. It is also the key precursor used for preparing rhodamine 101 sulfonyl chloride (also called Texas Red/reg;, a trademark of Molecular Probes), Size: 25mg
Catalog Number: 76480-514
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Image Unavailable-103010-956

HiLyte* Fluor 594 acid, SE 1 mg

Description: HiLyte* Fluor 594 acid, SE, Synonym: HiLyte* Fluor 594 acid, NHS ester, an alternative to Alexa Fluor* 594 and DyLight Fluor* 594, Molecular Weight 848.94, Spectral Properties: Abs/Em = 593/616 nm, Solvent System: DMF/DMSO, Storage: -20 deg C, Form: Solid, Size: 1 mg
Catalog Number: 103010-956
Supplier: Anaspec Inc
Image Unavailable-103007-636

[Cys26]-beta-Amyloid (1-40) S26C beta-Amyloid (1-40) 1 mg

Description: [Cys26]-beta-Amyloid (1-40), S26C beta-Amyloid (1-40), Human, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVV, Purity: By HPLC greater than or equal to 95%, Molecular Weight: 4345.9, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-636
Supplier: Anaspec Inc
Image Unavailable-103006-398

Phytochelatin 5 PC5 1 mg

Description: Phytochelatin 5, PC5 glutathione-derived heavy metal-detoxifying peptide of higher plants consisting of 5 units of YGlu-Cys, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): (YE-C)5-G, Molecular Weight: 1236.4, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-398
Supplier: Anaspec Inc
Image Unavailable-103387-024

IgG3, Human Plasma 5mg

Description: IgG3, Human Plasma, Purity: >95% by SDS-PAGE analysis, Source: Human plasma, Molecular Weight: 170,000, Species: Human, Storage: 4 C, Form: Liquid, DO NOT FREEZE, Preservative: Sodium Azide, Concentration: 1.0 mg/ml, Size: 5mg
Catalog Number: 103387-024
Supplier: Innovative Research Inc
Image Unavailable-103385-330

IgG3, Human Plasma 1mg

Description: IgG3, Human Plasma, Purity: >95% by SDS-PAGE analysis, Source: Human plasma, Molecular Weight: 170,000, Species: Human, Storage: 4 C, Form: Liquid, DO NOT FREEZE, Preservative: Sodium Azide, Concentration: 1.0 mg/ml, Size: 1mg
Catalog Number: 103385-330
Supplier: Innovative Research Inc
833 - 848 of 485,990