Print…

You Searched For: Molecular+Bioproducts+Inc.


485,990  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"485990"

Rate These Search Results

Image Unavailable-103010-192

HiLyte*Fluor 647 acid SE 1 mg

Description: HiLyte*Fluor 647 acid, SE, Purity >/=95% HPLC, Molecular Weight: 1302.71, Solvent System: DMF or DMSO, is an excellent fluorescent labeling dye that generates the protein conjugates that are slightly red-shifted compared to those of Cy5 dye, Size: 1 mg
Catalog Number: 103010-192
Supplier: Anaspec Inc
Image Unavailable-103011-384

Thioflavin T 1 g

Description: Thioflavin T, UltraPure Grade, classic amyloid stain for senile plaques containing bA4 peptide in Alzheimer's disease brain, Molecular Weight: 318.9, Spectral Properties: Abs/Em = 412/482 nm, Solvent System: DMSO, CAS number: 2390-54-7, MF: C17H19ClN2S, Storage -20 deg C, Size: 1 g
Catalog Number: 103011-384
Supplier: Anaspec Inc
Image Unavailable-10172-540

Dulbecco's PBS: Dulbecco's PBS; 500 ml

Catalog Number: 10172-540
Supplier: Promocell, Inc.
Image Unavailable-10172-542

Dulbecco's PBS: Dulbecco's PBS, w/o Ca++/ Mg++; 500 ml

Catalog Number: 10172-542
Supplier: Promocell, Inc.
Image Unavailable-103003-268

GSK3 Substrate a b subunit 1 mg

Description: GSK3 Substrate, a, b subunit, Purity: HPLC >/- 95%, Molecular Weight: 2631.8, Sequence: RAAVPPSPSLSRHSSPHQSEDEEE, Appearance: White Powder, This is a GSK-3 substrate, it can be used as a substrate for both alpha and beta isoforms of GSK3, Size: 1 mg
Catalog Number: 103003-268
Supplier: Anaspec Inc
Image Unavailable-103003-342

Thrombin Receptor Agonist (FLLRN) 5 mg

Description: Thrombin Receptor Agonist (FLLRN), Purity: HPLC >/- 95%, Molecular Weight: 661.8, Sequence: H-Phe-Leu-Leu-Arg-Asn-OH, Appearance: Powder, This thrombin receptor agonist peptide is a PAR 1 antagonist peptide, Storage: -20 deg C, Size: 5 mg
Catalog Number: 103003-342
Supplier: Anaspec Inc
Image Unavailable-102996-724

Scrambled-beta-Amyloid (1-42) 1 mg

Description: Scrambled-beta-Amyloid (1-42), Human, Purity: HPLC >/= 95%, Molecular Weight: 4514.1, Sequence: AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA, Appearance: White Powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 102996-724
Supplier: Anaspec Inc
Image Unavailable-76485-598

Edans C5 Maleimide 619 5Mg, EDANS is one of the most popular donors for developing FRET-based nucleic acid probes (such as Molecular Beacons) and protease substrates. EDANS is often paired with DABCYL or DABSYL in FRET-based probes. Its fluorescence is environment-sensitive, Size: 5mg

Description: Edans C5 Maleimide 619 5Mg, EDANS is one of the most popular donors for developing FRET-based nucleic acid probes (such as Molecular Beacons) and protease substrates. EDANS is often paired with DABCYL or DABSYL in FRET-based probes. Its fluorescence is environment-sensitive, Size: 5mg
Catalog Number: 76485-598
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Image Unavailable-BJ79606-500ML

Ortho-phosphoric acid 500ML

Description: Ortho-phosphoric acid, Buffer Solution, Purity: 85-90%, Grade: Analytical, CAS number: 7664-38-2, Molecular formula: H3PO4, Molar Mass: 98 g/mol, Synonym: Orthophosphoric acid, Phosphoric acid, Appearance: Colorless, Liquid, C
Catalog Number: BJ79606-500ML
Supplier: Honeywell Research Chemicals

SDS Certificates


Image Unavailable-BJ79606-100ML

Ortho-phosphoric acid 100ML

Description: Ortho-phosphoric acid, Buffer Solution, Purity: 85-90%, Grade: Analytical, CAS number: 7664-38-2, Molecular formula: H3PO4, Molar Mass: 98 g/mol, Synonym: Orthophosphoric acid, Phosphoric acid, Appearance: Colorless, Liquid, C
Catalog Number: BJ79606-100ML
Supplier: Honeywell Research Chemicals

SDS Certificates


Image Unavailable-103011-232

Calcein blue, AM 1 mg

Description: Calcein blue, AM, Blue fluorescent cell viability indicator, Molecular Weight: 465.4, Spectral Properties: Abs/Em = 322/437 nm, Solvent System: DMSO, Physical State: Solid, Storage: -20 deg C, desiccated and protected from light, Store away from oxidizing agent, Size: 1 mg
Catalog Number: 103011-232
Supplier: Anaspec Inc
Image Unavailable-76485-592

6-Ned Alkyne 216 1Mg, 5'-Labeled primer pairs include a fluorescently labeled oligo with a choice of dye on the 5' end, along with an unlabeled oligo, in each pair. These products can be used in a variety of molecular biological applications, Size: 1mg

Description: 6-Ned Alkyne 216 1Mg, 5'-Labeled primer pairs include a fluorescently labeled oligo with a choice of dye on the 5' end, along with an unlabeled oligo, in each pair. These products can be used in a variety of molecular biological applications, Size: 1mg
Catalog Number: 76485-592
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Image Unavailable-103003-520

Mca [7-Methoxycoumarin-4-acetic acid] 1 g

Description: Mca [7-Methoxycoumarin-4-acetic acid], CAS Number: 62935-72-2, Molecular Formula: C12H10O5, Molecular Weight: 234.2, Absorption maximum (in MeOH): 320 nm Emission maximum (in MeOH): 380 nm, Storage: -20 deg C, size: 5 g
Catalog Number: 103003-520
Supplier: Anaspec Inc
Image Unavailable-103011-368

TMRE 25 mg

Description: TMRE, Synonym: Tetramethylrhodamine, ethyl ester, perchlorate, for measuring membrane potential of mitochondria; Fluorescence is less dependent on dye location, Molecular Weight: 514.96, Spectral Properties: Abs/Em = 549/574 nm, Solvent System: DMSO, CAS: 115532-52-0, Size: 25 mg
Catalog Number: 103011-368
Supplier: Anaspec Inc
Image Unavailable-103000-892

Beta - Amyloid (4 - 42), Human 1 mg

Description: Beta - Amyloid (4 - 42), Human, Purity: Peak Area By HPLC Greater than or equal to 95%, Molecular Weight: 4198.8, Sequence: FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103000-892
Supplier: Anaspec Inc
Image Unavailable-100206-672

56977-92-5,

Description: (R,R)-(-)-1,2-Bis[(o-methoxyphenyl)(phenyl)phosphino]ethane(1,5-cyclooctadiene)rhodium (I)tetrafluoroborate, purity: Min 95%, CAS number: 56977-92-5, molecular Formula: C36H40BF4O2P2Rh, Color: orange, Form: powder, Size: 0.5g
Catalog Number: 100206-672
Supplier: Strem Chemicals Inc
801 - 816 of 485,990