Print…

You Searched For: Aluminium magnesium isopropoxide


377,185  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"377185"

Rate These Search Results

Image Unavailable-103007-194

C34, gp41 HIV Fragment

Description: This C34 peptide, also known as HR2, belongs to the helical region of gp41 of HIV, C-terminal heptad repeat 2 (HR2) defined as C helix or C peptide. It is known that HIV-1 enters cells by membrane fusion, C34 gp41 peptide is a potent inhibitors of HIV-1 fusion.
Sequence:WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL
MW:4248.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103007-194
Supplier: Anaspec Inc
Image Unavailable-103007-786

HIV Gp91 TAT Peptide 2

Description: This peptide is a scrambled sequence of NADPH oxidase assembly peptide inhibitor gp91 ds-tat. It is used as a control peptide. It is two amino acid residues shorter at the N-terminus compared with the scrambled gp91 ds-tat.
Sequence: RKKRRQRRRCLRITRQSR-NH2
MW: 2453 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Catalog Number: 103007-786
Supplier: Anaspec Inc
Image Unavailable-102996-258

Human;Sheep;Rat PACAP (6-38), amide

Description: This peptide is a potent antagonist of PACAP 38 and is much more potent and selective than PACAP (6-27) in the inhibition of PACAP-27 stimulated pituitary adenylate cyclase. The Ki values for the inhibition of the enzyme are 7nM and 150 nM, respectively.
Sequence: FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
MW: 4024.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Catalog Number: 102996-258
Supplier: Anaspec Inc
Image Unavailable-102998-432

Human ACTH (18-39)

Description: This ACTH (18-39) fragment is known as the Corticotropin-like Intermediate Lobe Peptide. It stimulates insulin secretion as well as amylase and protein secretion in a dose-dependent manner similar to those of secretin and carbamylcholine.
Sequence: RPVKVYPNGAEDESAEAFPLEF
MW: 2465.7 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Catalog Number: 102998-432
Supplier: Anaspec Inc
Image Unavailable-103006-502

[Asp370]-Tyrosinase (368-376)

Description: This tumor antigenic peptide presented by HLA-A2 antigen to CTLs, is a tyrosinase fragment. Tyrosinase is a membrane-bound protein involved in the melanin synthesis pathway that is expressed by virtually all primary melanoma lesions and by most of metastatic lesions.
Sequence:YMDGTMSQV
MW:1031.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103006-502
Supplier: Anaspec Inc
Image Unavailable-103007-388

Jak3tide

Description: This peptide is a substrate for Jak3. It may be used used in kinase assays. Jak3tide contains the phosphorylation site at Tyr7.
Sequence:GGEEEEYFELVKKKK
MW:1813 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103007-388
Supplier: Anaspec Inc
Product Image-470230-928

3B Scientific® Cell Anatomy Models Bundle

Description: Modeled After EM Scans.
Catalog Number: 470230-928
Supplier: VWR
Image Unavailable-103007-864

Syk Kinase Peptide Substrate, Biotin

Description: This synthetic peptide is a biotinylated substrate for Syk kinase.
Sequence:Biotin-KEDPDYEWPSAK-NH2
MW:1689.9 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103007-864
Supplier: Anaspec Inc
Image Unavailable-103815-480

Human Recombinant SLC1A5 (from E. coli)

Description: Human SLC1A5 Protein Tag, TrxA Tag, ACROBiosystems
Catalog Number: 103815-480
Supplier: ACROBIOSYSTEMS
Image Unavailable-103003-160

Rat Rat Renin Inhibitor Peptide

Description: A specific rat renin inhibitor.
Sequence:Ac - HPFV - (Sta) - LF - NH2
MW:957.3 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Catalog Number: 103003-160
Supplier: Anaspec Inc
Image Unavailable-103007-294

ACE2 Inhibitor

Description: A potent inhibitor specific for ACE2. It has a Ki of 2.8 nM.
Sequence:Ac-GDYSHCSPLRYYPWWKCTYPDPEGGG-NH2
MW:3076.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Catalog Number: 103007-294
Supplier: Anaspec Inc
Image Unavailable-103009-016

Histone H3 (1-8)

Description: This peptide corresponds to amino acid residues 1-8 of histone H3.
Sequence:ARTKQTAR
MW:931.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103009-016
Supplier: Anaspec Inc
Image Unavailable-102998-434

Human ACTH (1-10)

Description: Centrally administered N-terminal fragments of ACTH (1-10, 4-10, 4-9) display convulsant properties in rabbits.
Sequence: SYSMEHFRWG
MW: 1299.4 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Catalog Number: 102998-434
Supplier: Anaspec Inc
Image Unavailable-100198-786

Dichloro[(S)-(-)-2,2',6,6'-tetramethoxy-4,4'-bis(di(3,5-xylyl)phosphino)-3,3'-bipyridine][(1S,2S)-(-)-1,2-diphenylethylenediamine]ruthenium(II) ≥95%

Description: P-PHOS
Catalog Number: 100198-786
Supplier: Strem Chemicals Inc
Product Image-10128-480

Sodium acetate 3 M in aqueous solution, sterile filtered

Description: Sodium Acetate, 3M pH 5.2 is a common molecular biology reagent. All production lots are tested to ensure that they are free of Dnase, Rnase & Proteases. It is often used in buffer systems to maintain the pH of a given solution.
Catalog Number: 10128-480
Supplier: QUALITY BIOLOGICAL, INC.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Image Unavailable-103007-348

Human; Mouse; Rat Beta-Amyloid (25-35), Biotin

Description: This peptide is amino acids 25 to 35 fragment of the ß-amyloid biotinylated at C-terminus. This peptide possesses many of the characteristics of the full-length ß-amyloid peptide, including an amphiphilic nature and an ability to aggregate, and can serve as a model system to study the conformational changes involved in Alzheimer's disease. Aggregates of ß-amyloid (25–35) have been shown to possess the neurotrophic and neurotoxic properties of their full-length counterparts and there is evidence that the monomeric form of the peptide may itself be cytotoxic.
Sequence: Biotin-GSNKGAIIGLM
Molecular Weight: 1286.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Catalog Number: 103007-348
Supplier: Anaspec Inc
1 - 16 of 377,185