Print…

You Searched For: Molecular+Bioproducts+Inc.


485,990  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"485990"

Rate These Search Results

Product Image-76484-658

Amplite/Trade Fluor 11105, Protein quantification is an essential task in protein purification, electrophoresis, cell biology, molecular biology and other research applications. Biuret, Lowry, BCA and Bradford assays are routinely used for estimating protein concentration.

Description: Amplite/Trade Fluor 11105, Protein quantification is an essential task in protein purification, electrophoresis, cell biology, molecular biology and other research applications. Biuret, Lowry, BCA and Bradford assays are routinely used for estimating protein concentration.
Catalog Number: 76484-658
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Product Image-76485-738

Gelite/Trade Safe D 17703 10Ml, Upon binding to nucleic acids, Gelite™ Safe exhibits a considerable fluorescence enhancement by several orders of magnitude greater than that of EtBr, Size: 10ml

Description: Gelite/Trade Safe D 17703 10Ml, Upon binding to nucleic acids, Gelite™ Safe exhibits a considerable fluorescence enhancement by several orders of magnitude greater than that of EtBr, Size: 10ml
Catalog Number: 76485-738
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Product Image-76485-736

Gelite/Trade Safe D 17702 1Ml, Upon binding to nucleic acids, Gelite™ Safe exhibits a considerable fluorescence enhancement by several orders of magnitude greater than that of EtBr, Size: 1ml

Description: Gelite/Trade Safe D 17702 1Ml, Upon binding to nucleic acids, Gelite™ Safe exhibits a considerable fluorescence enhancement by several orders of magnitude greater than that of EtBr, Size: 1ml
Catalog Number: 76485-736
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Product Image-76485-734

Gelite/Trade Safe D 17701 500Ul, Upon binding to nucleic acids, Gelite™ Safe exhibits a considerable fluorescence enhancement by several orders of magnitude greater than that of EtBr, Size: 500µl

Description: Gelite/Trade Safe D 17701 500Ul, Upon binding to nucleic acids, Gelite™ Safe exhibits a considerable fluorescence enhancement by several orders of magnitude greater than that of EtBr, Size: 500µl
Catalog Number: 76485-734
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Product Image-76485-732

Gelite/Trade Safe D 17700 100Ul, Upon binding to nucleic acids, Gelite™ Safe exhibits a considerable fluorescence enhancement by several orders of magnitude greater than that of EtBr, Size: 100µl

Description: Gelite/Trade Safe D 17700 100Ul, Upon binding to nucleic acids, Gelite™ Safe exhibits a considerable fluorescence enhancement by several orders of magnitude greater than that of EtBr, Size: 100µl
Catalog Number: 76485-732
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Image Unavailable-102996-232

Neuropeptide Y 1 mg

Description: Neuropeptide Y, human, rat, Purity: HPLC >/= to 95%, Molecular Weight: 4271.8, Sequence: YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 102996-232
Supplier: Anaspec Inc
Image Unavailable-103372-782

5-Aminolevulinic acid hydrochloride 250G

Description: 5-Aminolevulinic acid hydrochloride, CAS Number: 5451-09-2, Molecular Formula: C5H10ClNO3, Molecular weight: 167.59 g/mol, Synonyms: delta-Aminolevulinic acid hydrochloride; 5-Amino-4-oxopentanoic acid HCl, size: 250G
Catalog Number: 103372-782
Supplier: Biosynth International Inc

SDS


Image Unavailable-103372-786

5-Aminolevulinic acid hydrochloride 1000G

Description: 5-Aminolevulinic acid hydrochloride, CAS Number: 5451-09-2, Molecular Formula: C5H10ClNO3, Molecular weight: 167.59 g/mol, Synonyms: delta-Aminolevulinic acid hydrochloride; 5-Amino-4-oxopentanoic acid HCl, size: 1000G
Catalog Number: 103372-786
Supplier: Biosynth International Inc

SDS


Image Unavailable-103372-784

5-Aminolevulinic acid hydrochloride 500G

Description: 5-Aminolevulinic acid hydrochloride, CAS Number: 5451-09-2, Molecular Formula: C5H10ClNO3, Molecular weight: 167.59 g/mol, Synonyms: delta-Aminolevulinic acid hydrochloride; 5-Amino-4-oxopentanoic acid HCl, size: 500G
Catalog Number: 103372-784
Supplier: Biosynth International Inc

SDS


Image Unavailable-103372-284

5-Aminolevulinic acid hydrochloride 100G

Description: 5-Aminolevulinic acid hydrochloride, CAS Number: 5451-09-2, Molecular Formula: C5H10ClNO3, Molecular weight: 167.59 g/mol, Synonyms: delta-Aminolevulinic acid hydrochloride; 5-Amino-4-oxopentanoic acid HCl, size: 100G
Catalog Number: 103372-284
Supplier: Biosynth International Inc

SDS


Image Unavailable-103007-866

Syk Kinase Peptide Substrate 1 mg

Description: Syk Kinase Peptide Substrate, Sequence: KEDPDYEWPSAK-NH2, Purity: By HPLC greater than or equal to 95%, This synthetic peptide is a substrate for Syk kinase, Molecular Weight: 1463.6, Apperance: Off-White solid, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-866
Supplier: Anaspec Inc
Image Unavailable-103003-538

Biotin - beta - Amyloid (1 - 40) 0.1 mg

Description: Biotin - beta - Amyloid (1 - 40), Human, Purity: HPLC >/- 95%, Molecular Weight: 4556.2, Appearance: Lyophilized white powder, Sequence: Biotin-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, Storage -20 deg C, size: 0.1 mg
Catalog Number: 103003-538
Supplier: Anaspec Inc
Image Unavailable-103003-300

Biotin cadaverine 25 mg

Description: Biotin cadaverine [[N-(5-Aminopentyl)biotinamide, trifluoroacetic acid salt]], Molecular Weight: 442.5, Appearance: solid, Solvent System: DMSO or DMF, Building block for modifying carboxy and carbonyl groups, substrate for transglutaminase, Storage: -20 deg C, Size: 25 mg
Catalog Number: 103003-300
Supplier: Anaspec Inc
Image Unavailable-102998-174

UOM9, PKC Substrate, phosphorylated 1 mg

Description: UOM9, PKC Substrate, phosphorylated, Purity: % Peak Area By HPLC greater than or equal to 95%, Molecular Weight: 1422.5, Sequence(One-Letter Code) : KRP-pS-QRHGSKY-NH2, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1mg
Catalog Number: 102998-174
Supplier: Anaspec Inc
Image Unavailable-102998-830

VSV - G Peptide 1mg

Description: VSV - G Peptide, vesicular stomatitis virus G (VSV-G) protein fragment, Physical State: Powder, Molecular Weight 1339.5, Sequence (One-Letter Code) : TDIEMNRLGK, Sequence (Three-Letter Code) H - Tyr - Thr - Asp - Ile - Glu - Met - Asn - Arg - Leu - Gly - Lys - OH, Size: 1mg
Catalog Number: 102998-830
Supplier: Anaspec Inc
Image Unavailable-103010-922

1 - Pyrenebutanoic acid, succinimidyl ester 100 mg

Description: 1 - Pyrenebutanoic acid, succinimidyl ester, UVexcitable amino-reactive fluorophore, used to develop ratiometric fluorescent membrane probe, Molecular Weight: 385.42, Spectral Properties: Abs/Em = 340/376 nm, Solvent System: DMF/DMSO, Size: 100 mg
Catalog Number: 103010-922
Supplier: Anaspec Inc
769 - 784 of 485,990