You Searched For: Molecular+Bioproducts+Inc.

Catalog Number: (103008-214)

Supplier: Anaspec Inc

Description: Prostatic Acid Phosphatase (248-286), PAP (248-286) peptide is a semen-derived enhancer of viral infection (SEVI) factor found in semen. This peptide greatly increases HIV infection through enhanced virion attachment to target cells.
Sequence:GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY
MW:4551.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Anaspec Inc

Description: This peptide is angiontensin I (Ang I) with valine and isoleucine universally labeled with 13C and N. Ang I is a precursor to Ang II, which has been implicated in cardiovascular functions, cell proliferation, fibrosis, and apoptosis. The 10-mer Ang I peptide is converted to Ang II through the cleavage of the Phe8-His9 bond of Ang I by angiotensin-converting enzyme (ACE) or human chymase.

Catalog Number: (103008-450)

Supplier: Anaspec Inc

Description: This is amino acids 73 to 92 fragment of bone morphogenetic protein (BMP) knuckle epitope. It is a member of transforming growth factor beta (TGF-B). This peptide fragment is able to raise alkaline phosphate activity in murine multipotent mesenchymal cell
Sequence:KIPKASSVPTELSAISTLYL
MW:2118.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Anaspec Inc

Description: This peptide is derived from Histone H3 21-44 amino acids, with additional glycine and lysine at the C-terminus with lysine biotinylated and used as substrate in methylation assays.
Sequence:ATKAARKSAPATGGVKKPHRYRPG-GK(Biotin)
MW:2917.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Description: 5-TAMRA is the purified single isomer of 5(6)-TAMRA. It is preferred for some complicated biological applications where reproducibility is more critical than material cost since the minor positional difference between 5-TAMRA and 6-TAMRA might affect some biological properties of the underlying conjugates.

Catalog Number: (103003-274)

Supplier: Anaspec Inc

Description: TET 830 modified/T-helper epitope from tetanus toxoid is a universal human tetanus toxin T cell epitope. It induces T-cell activation and is used as a helper peptide in vaccinations.
Sequence:AQYIKANSKFIGITEL
MW:1797.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (76303-684)

Supplier: PeproTech, Inc.

Description: FGF-4 is a heparin-binding growth factor that is a member of the FGF family. Proteins of this family play a central role during prenatal development, postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-4 signals through FGFR 1c, 2c, 3c, and 4. Recombinant Human FGF-4 is a 19.7 kDa protein consisting of 182 amino acid residues.

Sale

Supplier: BIOGEMS INTERNATIONAL INC.

Description: 2-NBDG can be used as a fluorescent indicator for the monitoring of glucose uptake in living cells

Catalog Number: (76777-150)

Supplier: VWR International

Description: VWR® Nano Spectrophotometer is designed to simplify and accelerate your molecular biology research and routine applications.

Sale

Catalog Number: (103007-366)

Supplier: Anaspec Inc

Description: This is a modified beta-amyloid (1-42) peptide wherein at position 35, the methionine is in an oxidized state. The Methionine residue at position 35 has been shown to be responsible for the oxidative stress and neurotoxic properties both in vitro and in vivo. In addition, Aβ- bearing oxidized Met-35 is found in considerable amounts in post-mortem AD plaques and the accumulation of oxidized Met-35 seems to be related to reduced enzymatic reversal of methionine sulfoxide back to methionine observed in AD brains.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-M(O)-VGGVVIA
Molecular Weight: 4530.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Sale

Supplier: PeproTech, Inc.

Description: RELMβ (Resistin-like molecule β/FIZZ2) is a disulfide-linked, homodimeric protein expressed in the epithelium of the colon and small bowel. The biological functions of RELMβ, and its molecular targets, are not fully known, but it has been suggested that it plays a regulatory role during inflammation, and may also act to establish links among adipose tissue, the intestine and the liver. Interestingly, the molecular structure of RELMβ is highly homologous to that of the adipose-derived cytokines, resistin and RELMα. These proteins share a highly conserved C-terminal domain, characterized by 10 cysteine residues with a unique spacing motif of C-X11-C-X8-C-X-C-X3-C-X10-C-X-C-X-C-X9-C-C. Recombinant Murine RELMβ is an 18.0 kDa protein, consisting of two identical 83 amino acid polypeptide chains linked by a single disulfide bond.

Supplier: General Separation Technologies, Inc.

Description: Typical Application: Air, Argon, CO, Hydrogen, Natural gas, Nitrogen Oxides, Noble gases, Refinery has, SF6.

Catalog Number: (76483-402)

Supplier: AAT BIOQUEST INC

Description: MM 2-10 (FM 2-10) is the abbreviation of our Membrane Marker 2-10, chemically called N-(3-triethylammoniumpropyl)-4-(4-(diethylamino)styryl)pyridinium dibromide.

Sale

Supplier: ACROBIOSYSTEMS

Description: Recombinant HRSV (A) glycoprotein G, Host: HEK293, Species Reactivity: HRSV, Purity: >90% by SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at the C-terminus, calculated MW of 26.2 kDa, Synonym: RSV-G, G, mG, Storage: 4 deg C, Size: 1mg

Supplier: ACROBIOSYSTEMS

Description: Glutaredoxin 1/GLRX1 Protein, Host: HEK293 Cells, Species reactivity: Human, Purity: >95%SDS-PAGE, Molecular Characterization: Fused with polyhistidine tag at the N-terminus, MW of 12.7 kDa, Synonym: GLRX, GRX, TTase-1, GLRX1, GRX1, Size: 100ug

Supplier: ACROBIOSYSTEMS

Description: Human SMAC/Diablo Protein, Host: E.coli cells, Species Reactivity: Human, purity: >95% SDS-PAGE, Molecular Characterization: fused with GST tag at the C-terminus, MW of 21.7 kDa, Synonym: DIABLO,SMAC, Storage: 4 Degree C, size: 1mg