You Searched For: Molecular+Bioproducts+Inc.

Supplier: PeproTech, Inc.

Description: Vitronectin is a secreted glycoprotein that is synthesized in the liver. It circulates primarily in monomeric form, but can undergo conformational change to a structure that forms disulfide-linked multimers. The multimeric vitronectin can efficiently bind to, and incorporate into, the extracellular matrix. Within the matrix, vitronectin can support cell adhesion through binding to various integrins and other proteoglycans. Additionally, recombinant vitronectin can function as a chemically defined matrix component in human embryonic stem cell renewal media. Recombinant Human Vitronectin is a 459 amino acid, single-chain, monomeric protein, which migrates at an apparent molecular weight of 75 kDa by SDS-PAGE under reducing conditions. The calculated molecular weight of Recombinant Human Vitronectin is 52.2 kDa. Manufactured using all Animal-Free reagents.

Catalog Number: (103003-898)

Supplier: Anaspec Inc

Description: c-Myc, the product of the c-myc proto-oncogene, is a helix-loop-helix leucine zipper phosphoprotein that regulates gene transcription in cell proliferation, cell differentiation and apoptosis. This peptide is a human c-myc epitope.
Sequence:EQKLISEEDL
MW:1203.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103007-802)

Supplier: Anaspec Inc

Description: This truncated Exendin-4 peptide, Exendin (5-39) amide, is a potent Glucagon-Like Peptide 1 (GLP-1) receptor antagonist. Unlike the full length Exendin-4 (a GLP-1 agonist), Exendin (9-39) antagonizes GLP-1–stimulated insulin release after food intake.
Sequence: TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
MW: 3806.3 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Sale

Catalog Number: (103008-214)

Supplier: Anaspec Inc

Description: Prostatic Acid Phosphatase (248-286), PAP (248-286) peptide is a semen-derived enhancer of viral infection (SEVI) factor found in semen. This peptide greatly increases HIV infection through enhanced virion attachment to target cells.
Sequence:GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY
MW:4551.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103008-450)

Supplier: Anaspec Inc

Description: This is amino acids 73 to 92 fragment of bone morphogenetic protein (BMP) knuckle epitope. It is a member of transforming growth factor beta (TGF-B). This peptide fragment is able to raise alkaline phosphate activity in murine multipotent mesenchymal cell
Sequence:KIPKASSVPTELSAISTLYL
MW:2118.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: ACROBIOSYSTEMS

Description: Cynomolgus Axl Protein, His Tag, ACROBiosystems

Supplier: ACROBIOSYSTEMS

Description: B18R Protein, Host: HEK293 Cells, Species reactivity: Vaccinia Virus, Purity: >95% as determined by SDS-PAGE, Molecular Characterization: His Tag is Fused with a polyhistidine tag at the C-terminus, Molecular weight of 40.3 kDa, Synonym: B18R, Size: 500ug

Supplier: ACROBIOSYSTEMS

Description: Mouse ICOS / CD278 (C137S, C138S) Protein, Fc Tag, ACROBiosystems

Supplier: ACROBIOSYSTEMS

Description: Human NKp46 / NCR1 / CD335 Protein, His Tag, ACROBiosystems

Supplier: ACROBIOSYSTEMS

Description: Osteoactivin/GPNMB Protein, Host: HEK293 Cells, Species reactivity: Human, Purity: >95% by SDS-PAGE, Molecular Characterization: Fused with 6xHis tag at the C-terminus, Molecular weight of 52.9 kDa, Synonym: GPNMB, HGFIN, NMB, Osteoactivin, Size: 100ug

Catalog Number: (103007-538)

Supplier: Anaspec Inc

Description: This amino acids 11 to 22 fragment of b-amyloid is capable of forming well-organized amyloid fibrils in vitro, similar to the pathogenic ones found in amyloidosis. Analysis of the structural properties of one monomer of b-amyloid (11-22) as well as of the aggregation mechanisms for four chains of b-amyloid (11-22) showed that the system assembles rapidly into a random globular state that evolves into three- and four-stranded antiparallel beta-sheets. The aggregation process is considerably accelerated by the presence of preformed dimers.
Sequence: EVHHQKLVFFAEDVG
Molecular Weight: 1755 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Sale

Catalog Number: (103003-274)

Supplier: Anaspec Inc

Description: TET 830 modified/T-helper epitope from tetanus toxoid is a universal human tetanus toxin T cell epitope. It induces T-cell activation and is used as a helper peptide in vaccinations.
Sequence:AQYIKANSKFIGITEL
MW:1797.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: ACROBIOSYSTEMS

Description: Fetuin A/FETUA Protein, Host: HEK293 Cells, Species reactivity: Human, Purity: >98% by SDS-PAGE, Molecular Characterization: His Tag is Fused with a polyhistidine tag at the C-terminus, Molecular weight of 38.2 kDa, Synonym: AHSG, FETUA, Fetuin A, Size: 100ug

Catalog Number: (103007-366)

Supplier: Anaspec Inc

Description: This is a modified beta-amyloid (1-42) peptide wherein at position 35, the methionine is in an oxidized state. The Methionine residue at position 35 has been shown to be responsible for the oxidative stress and neurotoxic properties both in vitro and in vivo. In addition, Aβ- bearing oxidized Met-35 is found in considerable amounts in post-mortem AD plaques and the accumulation of oxidized Met-35 seems to be related to reduced enzymatic reversal of methionine sulfoxide back to methionine observed in AD brains.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-M(O)-VGGVVIA
Molecular Weight: 4530.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Sale

Catalog Number: (103815-514)

Supplier: ACROBIOSYSTEMS

Description: Human CD47 Protein, His Tag, low endotoxin, ACROBiosystems

Sale

Supplier: General Separation Technologies, Inc.

Description: Typical Application: Air, Argon, CO, Hydrogen, Natural gas, Nitrogen Oxides, Noble gases, Refinery has, SF6.