Print…

You Searched For: Molecular+Bioproducts+Inc.


485,990  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"485990"

Rate These Search Results

Product Image-10128-244

LB Broth (Luria Bertani, Miller), 500ml, light amber, clear to slightly opalescent liquid

Catalog Number: 10128-244
Supplier: QUALITY BIOLOGICAL, INC.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Product Image-10128-246

LB Broth (Luria Bertani, Miller), 10x500ml, light amber, clear to slightly opalescent liquid

Catalog Number: 10128-246
Supplier: QUALITY BIOLOGICAL, INC.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Product Image-10128-248

LB Broth (Luria Bertani, Miller), 1000ML, light amber, clear to slightly opalescent liquid

Catalog Number: 10128-248
Supplier: QUALITY BIOLOGICAL, INC.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Product Image-10128-250

LB Broth (Luria Bertani, Miller), 10x1L, light amber, clear to slightly opalescent liquid

Catalog Number: 10128-250
Supplier: QUALITY BIOLOGICAL, INC.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Image Unavailable-102999-792

Beta - Amyloid (1 - 40) 1 mg

Description: Beta - Amyloid (1 - 40), Human, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4329.9, post-secretory aggregation and deposition in the Alzheimer’s disease brain, Size: 1 mg
Catalog Number: 102999-792
Supplier: Anaspec Inc
Image Unavailable-102999-794

Beta - Amyloid (1 - 40) 5 mg

Description: Beta - Amyloid (1 - 40), Human, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4329.9, post-secretory aggregation and deposition in the Alzheimer’s disease brain, Size: 5 mg
Catalog Number: 102999-794
Supplier: Anaspec Inc
Image Unavailable-102999-790

Beta - Amyloid (1 - 40) 0.5 mg

Description: Beta - Amyloid (1 - 40), Human, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4329.9, post-secretory aggregation and deposition in the Alzheimer’s disease brain, Size: 0.5 mg
Catalog Number: 102999-790
Supplier: Anaspec Inc
Product Image-10128-252

LB Broth (Luria Bertani, Miller), 4x100ml, light amber, clear to slightly opalescent liquid

Catalog Number: 10128-252
Supplier: QUALITY BIOLOGICAL, INC.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Image Unavailable-103011-056

DABCYL Plus* C2 maleimide 10 mg

Description: DABCYL Plus* C2 maleimide, thiol-reactive building block for developing DABCYL Plus*-based FRET probes, Purity: 95%, Molecular Weight: 570.62, Spectral Properties: Abs/Em = 430/none nm, Solvent System: Water or DMSO, Form: Solid, Storage -20 deg C, Size: 10 mg
Catalog Number: 103011-056
Supplier: Anaspec Inc
Image Unavailable-76481-820

5'-DABCYL C6 phosphoramidite, DABCYL is one of the most commonly used dark quenchers for labeling oligos and peptides. The resulted conjugates are widely used as diagnostic probes such as Molecular Beacons and protease substrates, Size: 1g

Description: 5'-DABCYL C6 phosphoramidite, DABCYL is one of the most commonly used dark quenchers for labeling oligos and peptides. The resulted conjugates are widely used as diagnostic probes such as Molecular Beacons and protease substrates, Size: 1g
Catalog Number: 76481-820
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Image Unavailable-75800-204

Polyethylenimine 100g

Description: Polyethylenimine, Branched, CAS no: 9002-98-6, Molecular Weight: 10,000 (bPEI 10000), Density: 1.029-1.038, Viscosity: 40,000 - 150,000 cps, Soluble In: water, lower alcohols, glycols, and THF, Resin Content (wt%): 99%, Appearance: clear light yellow viscous liquid, Size: 100g
Catalog Number: 75800-204
Supplier: Polysciences Inc

SDS


Image Unavailable-75800-206

Polyethylenimine 500g

Description: Polyethylenimine, Branched, CAS no: 9002-98-6, Molecular Weight: 10,000 (bPEI 10000), Density: 1.029-1.038, Viscosity: 40,000 - 150,000 cps, Soluble In: water, lower alcohols, glycols, and THF, Resin Content (wt%): 99%, Appearance: clear light yellow viscous liquid, Size: 500g
Catalog Number: 75800-206
Supplier: Polysciences Inc

SDS


Image Unavailable-103010-932

HiLyte* Fluor 555 acid 5 mg

Description: HiLyte* Fluor 555 acid, slightly red-shifted compared to Cy3 dyes, result in an optimal match to filter, Molecular Weight: 869.1, Spectral Properties: Abs/Em = 550/566 nm, Solvent System: Water, Form: Solid, Storage -20 deg C, desiccated/protected from light, Size: 5 mg
Catalog Number: 103010-932
Supplier: Anaspec Inc
Product Image-76483-320

Coelenterazine H 21165 10Mg, Calcium measurement is critical for numerous biological investigations. The aequorin complex comprises a 22 kD apoaequorin protein, molecular oxygen and the luminophore coelenterazine, Size: 10mg

Description: Coelenterazine H 21165 10Mg, Calcium measurement is critical for numerous biological investigations. The aequorin complex comprises a 22 kD apoaequorin protein, molecular oxygen and the luminophore coelenterazine, Size: 10mg
Catalog Number: 76483-320
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Product Image-76483-316

Coelenterazine H 21153 250Ug, Calcium measurement is critical for numerous biological investigations. The aequorin complex comprises a 22 kD apoaequorin protein, molecular oxygen and the luminophore coelenterazine, Size: 250µG

Description: Coelenterazine H 21153 250Ug, Calcium measurement is critical for numerous biological investigations. The aequorin complex comprises a 22 kD apoaequorin protein, molecular oxygen and the luminophore coelenterazine, Size: 250µG
Catalog Number: 76483-316
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Product Image-76483-318

Coelenterazine H 21159 1Mg, Calcium measurement is critical for numerous biological investigations. The aequorin complex comprises a 22 kD apoaequorin protein, molecular oxygen and the luminophore coelenterazine, Size: 1mg

Description: Coelenterazine H 21159 1Mg, Calcium measurement is critical for numerous biological investigations. The aequorin complex comprises a 22 kD apoaequorin protein, molecular oxygen and the luminophore coelenterazine, Size: 1mg
Catalog Number: 76483-318
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


737 - 752 of 485,990