Print…

You Searched For: Molecular+Bioproducts+Inc.


377,146  results were found

Refine Results Sort by
SearchResultCount:"377146"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-103815-496

Human Recombinant EGF R (from HEK293 Cells)

Catalog Number: (103815-496)
Supplier: ACROBIOSYSTEMS
Description: Human EGF R Protein, His Tag, low endotoxin, ACROBiosystems
Product Image-76777-150

VWR® Nano Spectrophotometer

Catalog Number: (76777-150)
Supplier: VWR International
Description: VWR® Nano Spectrophotometer is designed to simplify and accelerate your molecular biology research and routine applications.
Image Unavailable-102996-888

S6 Kinase Substrate (229-239),Biotin

Catalog Number: (102996-888)
Supplier: Anaspec Inc
Description: This is a biotinylated synthetic peptide substrate for S6 kinase.
Sequence:Biotin-AKRRRLSSLRA-NH2
MW:1538.9 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-10779-426

Human Recombinant Vitronectin (from HEK293 Cells)

Supplier: PeproTech, Inc.
Description: Vitronectin is a secreted glycoprotein that is synthesized in the liver. It circulates primarily in monomeric form, but can undergo conformational change to a structure that forms disulfide-linked multimers. The multimeric vitronectin can efficiently bind to, and incorporate into, the extracellular matrix. Within the matrix, vitronectin can support cell adhesion through binding to various integrins and other proteoglycans. Additionally, recombinant vitronectin can function as a chemically-defined matrix component in human embryonic stem cell renewal media. Recombinant Human Vitronectin is a 459 amino acid, single-chain, monomeric protein, which migrates at an apparent molecular weight of 75 kDa by SDS-PAGE under reducing conditions. The calculated molecular weight of Recombinant Human Vitronectin is 52.2 kDa.

Image Unavailable-103007-596

Human;Mouse;Rat Beta-Amyloid (25-35), HiLyte™ Fluor 488

Catalog Number: (103007-596)
Supplier: Anaspec Inc
Description: This is amino acids 25 to 35 fragment of beta-amyloid peptide labeled with HiLyte™ Fluor 488, Abs/Em=503/528 nm.
Sequence: HiLyte™ Fluor 488-GSNKGAIIGLM
Molecular Weight: 1416.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103007-614

Mouse;Rat Beta-Amyloid (1-40)-Lys(Biotin)-NH2, Biotin

Catalog Number: (103007-614)
Supplier: Anaspec Inc
Description: This is amino acids 1 to 40 fragment of mouse and rat beta-amyloid differing from human beta-amyloid by three amino acid residues: Gly5, Phe10, and Arg13. This peptide is biotinylated at the C-terminus.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2
Molecular Weight: 4587.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Product Image-470230-954

Plant And Animal Cell Bundle

Catalog Number: (470230-954)
Supplier: VWR
Description: A full set of materials for cell comparison.
Image Unavailable-103007-746

HIV Gp91 Ds-Tat Peptide

Catalog Number: (103007-746)
Supplier: Anaspec Inc
Description: This peptide is composed of gp91phox sequence linked to the human immunodeficiency virus-tat peptide. The tat sequence facilitates the entry of this peptide into all cells. It is used as a peptide inhibitor for NADPH oxidase assembly.
Sequence: YGRKKRRQRRRCSTRIRRQL-NH2
MW: 2673.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-103003-004

Saccharomyces cerevisiae alpha-Mating Factor Pheromone

Catalog Number: (103003-004)
Supplier: Anaspec Inc
Description: This tridecapeptide, an alpha-factor pheromone of Saccharomyces cerevisiae, induces conjugation in yeast by binding to Ste2p. Its cognate GPCR activates a G protein signal pathway that highly conserves with mammalian signaling pathways.
Sequence:WHWLQLKPGQPMY
MW:1684 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103006-396

Cyclo (-RGDyK)

Catalog Number: (103006-396)
Supplier: Anaspec Inc
Description: This cyclic RGD peptide contains a subsituted d-Tyr instead of d-Phe on the fourth position. Substitution with Tyr results in a high affinity and selectivity for the avb3 integrin. Substitution with Tyr also allows for electrophilic radiohalogenation if desired.
Sequence:Cyclo(-RGDyK)
MW:619.7 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-726

Cyclo (RGDfC) Peptide

Catalog Number: (103007-726)
Supplier: Anaspec Inc
Description: This is a cyclic RGDfC sequence, an integrin avb3-affinity peptide.
Sequence:Cyclo(-RGDfC)
MW:578.7 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103008-616

[Arg(Me2a)8]-Histone H3(1-21)-K,Biotin

Catalog Number: (103008-616)
Supplier: Anaspec Inc
Description: This peptide is histone H3 amino acid residues 1 to 21. It is asymmetrically dimethylated at arginine 8 with both methyl groups added to one nitrogen of the guanidinium group, and contains a C-terminal biotinylated lysine.
Sequence:ARTKQTA-R(Me2a)-KSTGGKAPRKQLA-K(Biotin)-NH2
MW:2636.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103010-828

5(6)-TAMRA special formulation

Supplier: Anaspec Inc
Description: 5(6)-TAMRA is the mixture of two carboxy tetramethylrhodamine (TMR) isomers. It is used to modify amino and hydroxy groups using EDC-mediated couplings when there are difficulties in using 5(6)-TAMRA, SE. TAMRA is one of the most popular fluorophores used in various bioconjugations.

Image Unavailable-102996-444

Plasmin Substrate, AFC (Antibody-fluorophore conjugate)

Catalog Number: (102996-444)
Supplier: Anaspec Inc
Description: This is a fluorescent plasmin substrate, Abs/Em=380/500 nm.
Sequence:vLK-AFC
MW:569.5 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103009-014

ClearPoint™ Human Ang I Isotope Labeled

Supplier: Anaspec Inc
Description: This peptide is angiontensin I (Ang I) with valine and isoleucine universally labeled with 13C and N. Ang I is a precursor to Ang II, which has been implicated in cardiovascular functions, cell proliferation, fibrosis, and apoptosis. The 10-mer Ang I peptide is converted to Ang II through the cleavage of the Phe8-His9 bond of Ang I by angiotensin-converting enzyme (ACE) or human chymase.

Image Unavailable-103006-110

MBP (90-106)

Catalog Number: (103006-110)
Supplier: Anaspec Inc
Description: This peptide is a fragment of myelin basic protein (MBP), which corresponds to amino acids 88-102 in mouse, 88-104 in guinea pig and 89-105 in human. It is acetylated in N-term.
Sequence:Ac-FFKNIVTPRTPPPSQGK-NH2
MW:1956 Da
% peak area by HPLC:95
Storage condition:-20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
737 - 752 of 377,146
no targeter for Bottom