Print…

You Searched For: Molecular+Bioproducts+Inc.


485,990  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"485990"

Rate These Search Results

Product Image-470149-218

MOLECULAR MODEL SET INORG/ORG TCHR 232PC

Catalog Number: 470149-218
Supplier: VWR International
Image Unavailable-103007-242

LL - 37, reverse sequence 0.5 mg

Description: LL - 37, reverse sequence, Sequence: SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL, Purity: By HPLC greater than or equal to 95%, Molecular Weight: 4493.3, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 103007-242
Supplier: Anaspec Inc
Image Unavailable-103010-216

DiI [[1,1'-Dioctadecyl-3,3,3',3'- tetramethylindocarbocyanine iodide]] 100 mg

Description: DiI [[1,1'-Dioctadecyl-3,3,3',3'- tetramethylindocarbocyanine iodide]], Molecular Weight: 961.32, A lipophilic membrane stain that diffuses laterally to stain the entire cell, Storage: -20 deg C, size: 100 mg
Catalog Number: 103010-216
Supplier: Anaspec Inc
Image Unavailable-102996-334

GRGDSP 1 mg

Description: GRGDSP, Purity: HPLC >/= 95%, Molecular Weight: 587.6, Sequence: H-Gly-Arg-Gly-Asp-Ser-Pro-OH, Appearance: Lyophilized white powder, An inhibitor of cell attachment to salmosin and vitronectin, Storage: -20 deg C, Size: 1mg
Catalog Number: 102996-334
Supplier: Anaspec Inc
Image Unavailable-103007-720

S2238, Thrombin Substrate 1 mg

Description: S2238, Thrombin Substrate, Sequence: f-Pip-R-pNA, Purity: By HPLC greater than or equal to 95%, This is a chromogenic substrate for thrombin, Abs=405 nm, Molecular Weight: 552.6, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-720
Supplier: Anaspec Inc
Image Unavailable-103011-376

Prodan 25 mg

Description: Prodan, Synonym: 6 - Propionyl - 2 - dimethylaminonaphthalene, Environment-sensitive dye for studying membranes and structures of proteins, MW: 227.3, Spectral Properties: Abs/Em = 363/497 nm, Solvent System: DMF, Molecular Formula: C15H17NO, CAS No: 70504-01-7, Size: 25 mg
Catalog Number: 103011-376
Supplier: Anaspec Inc
Product Image-470014-408

MOLECULAR MODEL SET ORGANIC STUD 134PC

Catalog Number: 470014-408
Supplier: VWR International
Product Image-470014-294

MOLECULAR MODEL SET INORG/ORG BASIC 95PC

Catalog Number: 470014-294
Supplier: VWR International
Image Unavailable-103011-166

Indo-1, AM 1 mg

Description: Indo-1, AM, Emission-ratiometric fluorescent indicator for quantifying intracellular Ca2+ concentration, Molecular Weight: 1009.9, Spectral Properties: Abs/Em = 346/475 nm, Solvent System: DMSO, Molecular Formula: C47H51N3O22C47H51N3O22, CAS number: 112926-02-0, Size: 1 mg
Catalog Number: 103011-166
Supplier: Anaspec Inc
Image Unavailable-EM-4650

Formamide

Description: Methanamide. CAS RN 75-12-7. Deionized, OmniPur*, 99.0% min. For Molecular Biology. Conductivity: 100 µmhos max.; DNase, RNase, Protease: None detected. 500mL.
Catalog Number: EM-4650
Supplier: MilliporeSigma

SDS Certificates


Image Unavailable-103006-672

LL-37 scrambled 1 mg

Description: LL-37, scrambled, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR, Molecular Weight: 4493.3, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-672
Supplier: Anaspec Inc
Image Unavailable-103007-790

P70 S6 Kinase Substrate 1 mg

Description: P70 S6 Kinase Substrate, Sequence: KKRNRTLTV, Purity: By HPLC greater than or equal to 95%, This peptide is a substrate for p70 ribosomal S6 kinase, Molecular Weight: 1115.4, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-790
Supplier: Anaspec Inc
Image Unavailable-103011-408

HiLyte* Fluor 532 acid 5 mg

Description: HiLyte* Fluor 532 acid (HiLyte* Fluor series), with fluorescence excitation and emission of Approx 545 nm and Approx 565 nm, Molecular Weight: 778.34, Spectral Properties: Abs/Em = 545/565 nm, Solvent System: Water, Physical State: Solid, Storage: -20 deg C, Size: 5 mg
Catalog Number: 103011-408
Supplier: Anaspec Inc
Image Unavailable-101175-828

Water, Nuclease-Free

Description: 5 L
Catalog Number: 101175-828
Supplier: Thermo Fisher Scientific Chemicals Inc.
Image Unavailable-101175-318

Water, Nuclease-Free

Description: 1 L
Catalog Number: 101175-318
Supplier: Thermo Fisher Scientific Chemicals Inc.
Image Unavailable-103011-056

DABCYL Plus* C2 maleimide 10 mg

Description: DABCYL Plus* C2 maleimide, thiol-reactive building block for developing DABCYL Plus*-based FRET probes, Purity: 95%, Molecular Weight: 570.62, Spectral Properties: Abs/Em = 430/none nm, Solvent System: Water or DMSO, Form: Solid, Storage -20 deg C, Size: 10 mg
Catalog Number: 103011-056
Supplier: Anaspec Inc
705 - 720 of 485,990