You Searched For: Molecular+Bioproducts+Inc.

Catalog Number: (103008-450)

Supplier: Anaspec Inc

Description: This is amino acids 73 to 92 fragment of bone morphogenetic protein (BMP) knuckle epitope. It is a member of transforming growth factor beta (TGF-B). This peptide fragment is able to raise alkaline phosphate activity in murine multipotent mesenchymal cell
Sequence:KIPKASSVPTELSAISTLYL
MW:2118.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Strem Chemicals Inc

Description: P-PHOS

Catalog Number: (103007-364)

Supplier: Anaspec Inc

Description: This is amino acids 1 to 38 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid by three amino acid residues: Arg5, Tyr10, and His13 residues in human beta-amyloid correspond to Gly5, Phe10, and Arg13 in mice and rat sequence.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGG
Molecular Weight: 4035.5 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Sale

Catalog Number: (103006-452)

Supplier: Anaspec Inc

Description: A neuropeptide that plays a role in arousal and fear responses.
Sequence:SFRNGVGSGAKKTSFRRAKQ
MW:2182.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103006-450)

Supplier: Anaspec Inc

Description: A neuropeptide that plays a role in arousal and fear responses.
Sequence:SFRNGVGTGMKKTSFQRAKS
MW:2187.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Anaspec Inc

Description: Aß (1-28) is highly hydrophilic and shares sequences with bA4, the major component of Aß. Its assembly is fibrillar, i.e., elongated in a single direction. Reports show that synthetic peptides Aß (1-40) and Aß (1-28) have significant effects on normal human plasma cholesterol esterification rate.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNK
Molecular Weight: 3262.5 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103003-274)

Supplier: Anaspec Inc

Description: TET 830 modified/T-helper epitope from tetanus toxoid is a universal human tetanus toxin T cell epitope. It induces T-cell activation and is used as a helper peptide in vaccinations.
Sequence:AQYIKANSKFIGITEL
MW:1797.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103006-544)

Supplier: Anaspec Inc

Description: Several mutations within the β-amyloid precursor gene cause early onset familial Alzheimer's disease, and were shown to promote Aβ aggregation. In the arctic mutant, Glu 22 is replaced with Gly, resulting primarily in increased formation of Aβ protofibrils.
Sequence: DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVV
Molecular Weight: 4257.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Sale

Supplier: PeproTech, Inc.

Description: Vitronectin is a secreted glycoprotein that is synthesized in the liver. It circulates primarily in monomeric form, but can undergo conformational change to a structure that forms disulfide-linked multimers. The multimeric vitronectin can efficiently bind to, and incorporate into, the extracellular matrix. Within the matrix, vitronectin can support cell adhesion through binding to various integrins and other proteoglycans. Additionally, recombinant vitronectin can function as a chemically-defined matrix component in human embryonic stem cell renewal media. Recombinant Human Vitronectin is a 459 amino acid, single-chain, monomeric protein, which migrates at an apparent molecular weight of 75 kDa by SDS-PAGE under reducing conditions. The calculated molecular weight of Recombinant Human Vitronectin is 52.2 kDa.

Catalog Number: (103007-366)

Supplier: Anaspec Inc

Description: This is a modified beta-amyloid (1-42) peptide wherein at position 35, the methionine is in an oxidized state. The Methionine residue at position 35 has been shown to be responsible for the oxidative stress and neurotoxic properties both in vitro and in vivo. In addition, Aβ- bearing oxidized Met-35 is found in considerable amounts in post-mortem AD plaques and the accumulation of oxidized Met-35 seems to be related to reduced enzymatic reversal of methionine sulfoxide back to methionine observed in AD brains.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-M(O)-VGGVVIA
Molecular Weight: 4530.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Sale

Catalog Number: (102999-606)

Supplier: Anaspec Inc

Description: Aß (1-40) together with Aß (1-42) are two major C-terminal variants of the Aß protein constituting the majority of Aßs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. This Cys-containing mutant can be used as a model for aggregation studies.
Sequence: CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4433 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Sale

Supplier: General Separation Technologies, Inc.

Description: Typical Application: Air, Argon, CO, Hydrogen, Natural gas, Nitrogen Oxides, Noble gases, Refinery has, SF6.

Supplier: ACROBIOSYSTEMS

Description: Human PSCA Protein, His Tag, ACROBiosystems

Supplier: ACROBIOSYSTEMS

Description: Fc Tag fused with human IgG1 Fc tag at C-terminus

Catalog Number: (103013-172)

Supplier: ACROBIOSYSTEMS

Description: ActiveMax* Recombinant GM-CSF, Host: HEK293 Cells, Species reactivity: Human, Purity: >95% as determined by SDS-PAGE, Molecular Characterization: Tag Free, Molecular weight of 14.5 kDa, Synonym: GM-CSF, CSF2, MGC131935, Storage: 4 deg C, Size: 50ug

Sale

Supplier: ACROBIOSYSTEMS

Description: FcRn/FCGRT & B2M Heterodimer Protein, Host: HEK293 Cells, Species: Mouse, Purity: >95% SDS-PAGE, Molecular Characterization: fused with his-tag at the C-terminus, Molecular weight 33 kDa, Synonym: FcRn, FCGRT & B2M, Storage: at 4 deg C, Size: 50ug