Print…

You Searched For: Molecular+Bioproducts+Inc.


485,990  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"485990"

Rate These Search Results

Product Image-470014-298

MOLECULAR MODEL KIT GRAPHITE

Catalog Number: 470014-298
Supplier: VWR International
Product Image-470014-300

MOLECULAR MODEL KIT DIAMOND

Catalog Number: 470014-300
Supplier: VWR International
Product Image-470149-216

MOLECULAR MODEL SET BIOCHEM STUD 135PC

Catalog Number: 470149-216
Supplier: VWR International
Image Unavailable-103007-104

Beta - Amyloid (1 - 17 1 mg

Description: Beta - Amyloid (1 - 17, Human, Sequence: DAEFRHDSGYEVHHQKL, Purity: By HPLC greater than or equal to 95%, peptide employed in the b-Amyloid solubility studies, Molecular Weight: 2068.2, Apperance: Powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-104
Supplier: Anaspec Inc
Image Unavailable-103007-540

Beta-Amyloid (10-26) Human 1 mg

Description: Beta-Amyloid (10-26), Human, Sequence: YEVHHQKLVFFAEDVGS, Purity: By HPLC greater than or equal to 95%, This amino acids 10 to 26 fragment of beta-Amyloid peptide, capable of forming fibrils, Molecular Weight: 2005.2, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-540
Supplier: Anaspec Inc
Image Unavailable-103008-192

Beta-Amyloid (1-13) 1mg

Description: Beta-Amyloid (1-13), human, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1561.6, Sequence: DAEFRHDSGYEVH, H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-OH, Appearance: Powder, peptide is beta-Amyloid, human sequence, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-192
Supplier: Anaspec Inc
Product Image-470014-302

MOLECULAR MODEL KIT SODIUM CHLORIDE

Catalog Number: 470014-302
Supplier: VWR International
Image Unavailable-103007-598

Beta-Amyloid (11-42) Human 1 mg

Description: Beta-Amyloid (11-42), Human, Sequence: EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Purity: By HPLC >/= 95%, This peptide was detected in Alzheimer disease brains within several principal beta-amyloid variants, Molecular Weight: 3335.9, Storage: -20 C, Size: 1 mg
Catalog Number: 103007-598
Supplier: Anaspec Inc
Image Unavailable-76303-756

Recom Hek293 Tlr-4 >/= 95% Human 500 Ug

Description: TLR-4 Recombinant, Purity: >/= 95% by SDS-PAGE gel and HPLC, Source: HEK293 Cells, Reactivity: Human, Molecular mass of 69.3 kDa glycoprotein containing 609 aa residues of the TLR-4 extracellular domain, Synonyms: Toll-like receptor 4, TOLL, Size: 500 uG
Catalog Number: 76303-756
Supplier: PeproTech, Inc.
Image Unavailable-76303-754

Recom Hek293 Tlr-4 >/= 95% Human 250 Ug

Description: TLR-4 Recombinant, Purity: >/= 95% by SDS-PAGE gel and HPLC, Source: HEK293 Cells, Reactivity: Human, Molecular mass of 69.3 kDa glycoprotein containing 609 aa residues of the TLR-4 extracellular domain, Synonyms: Toll-like receptor 4, TOLL, Size: 250 uG
Catalog Number: 76303-754
Supplier: PeproTech, Inc.
Image Unavailable-76303-758

Recom Hek293 Tlr-4 >/= 95% Human 1 Mg

Description: TLR-4 Recombinant, Purity: >/= 95% by SDS-PAGE gel and HPLC, Source: HEK293 Cells, Reactivity: Human, Molecular mass of 69.3 kDa glycoprotein containing 609 aa residues of the TLR-4 extracellular domain, Synonyms: Toll-like receptor 4, TOLL, CD284, Size: 1 mg
Catalog Number: 76303-758
Supplier: PeproTech, Inc.
Image Unavailable-76303-752

Recom Hek293 Tlr-4 >/= 95% Human 100 Ug

Description: TLR-4 Recombinant, Purity: >/= 95% by SDS-PAGE gel and HPLC, Source: HEK293 Cells, Reactivity: Human, Molecular mass of 69.3 kDa glycoprotein containing 609 aa residues of the TLR-4 extracellular domain, Synonyms: Toll-like receptor 4, TOLL, Size: 100 uG
Catalog Number: 76303-752
Supplier: PeproTech, Inc.
Image Unavailable-76303-748

Recom Hek293 Tlr-4 >/= 95% Human 10 Ug

Description: TLR-4 Recombinant, Purity: >/= 95% by SDS-PAGE gel & HPLC, Source: HEK293 Cells, Reactivity: Human, Molecular mass of 69.3 kDa glycoprotein containing 609 aa residues of the TLR-4 extracellular domain, Synonyms: Toll-like receptor 4, TOLL, CD284, Size: 10 uG
Catalog Number: 76303-748
Supplier: PeproTech, Inc.
Image Unavailable-76303-750

Recom Hek293 Tlr-4 >/= 95% Human 50 Ug

Description: TLR-4 Recombinant, Purity: >/= 95% by SDS-PAGE gel & HPLC, Source: HEK293 Cells, Reactivity: Human, Molecular mass of 69.3 kDa glycoprotein containing 609 aa residues of the TLR-4 extracellular domain, Synonyms: Toll-like receptor 4, TOLL, CD284, Size: 50 uG
Catalog Number: 76303-750
Supplier: PeproTech, Inc.
Image Unavailable-EM-4650

Formamide

Description: Methanamide. CAS RN 75-12-7. Deionized, OmniPur*, 99.0% min. For Molecular Biology. Conductivity: 100 µmhos max.; DNase, RNase, Protease: None detected. 500mL.
Catalog Number: EM-4650
Supplier: MilliporeSigma

SDS Certificates


Image Unavailable-103010-904

NBD-X, SE 25 mg

Description: NBD-X, SE, CAS number: 145195-58-0, Synonym: Succinimidyl 6-(N-(7-nitrobenz-2-oxa-1,3-diazol-4-yl)amino)hexanoate; NBD-X, NHS ester, Molecular Weight: 391.34, Purity: >/= 95% by HPLC, Spectral Properties: Abs/Em = 466/535 nm, Solvent System: DMF or DMSO, Size: 25 mg
Catalog Number: 103010-904
Supplier: Anaspec Inc
689 - 704 of 485,990