Print…

You Searched For: Molecular+Bioproducts+Inc.


377,185  results were found

Refine Results Sort by
SearchResultCount:"377185"

Sort Results

List View Easy View (new)

Rate These Search Results

Product Image-76481-302

4-Dimethylaminoazobenzene-4'-carboxylic acid ≥95%

Catalog Number: (76481-302)
Supplier: AAT BIOQUEST INC
Description: DABCYL acid is one of the most popular acceptors for developing FRET-based nucleic acid probes suh as Molecular Beacon-based PCR probes.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Product Image-75997-546

VWR® DNA Molecular Weight Markers, 1 kb Ladder

Catalog Number: (75997-546)
Supplier: VWR
Description: 11 fragments ranging from 500 to 10,000 bp for easy band identification

SDS Certificates


Image Unavailable-103815-446

Human Recombinant PD-1 (from HEK293), PE Labeled Protein

Supplier: ACROBIOSYSTEMS
Description: PE-Labeled PD-1 PDCD1 Protein, Fc Tag, Recombinant, Source: HEK293, Species: human, Molecular weight: 44.7 kDa, Synonyms: DCD1, PD1, CD279, SLEB2, Size: 250 test

Product Image-76620-422

VWR® Glycerol-Free Taq DNA Polymerase

Supplier: VWR International
Description: VWR® Taq DNA Polymerase, glycerol-free, 5 U/µl is a thermostable recombinant DNA polymerase, which exhibits very high activity in primer extension and other molecular biology applications. The enzyme is isolated from Thermus aquaticus and has a molecular weight of approximately 94 kDa.

Product Image-76620-546

VWR® dNTPs

Supplier: VWR International
Description: Ready to use molecular biology grade dNTP mixes and dNTP sets.

Image Unavailable-103013-456

Human Recombinant Azurocidin (from HEK293 cells)

Supplier: ACROBIOSYSTEMS
Description: Azurocidin/CAP37/AZU1 Protein, Host: HEK293 Cells, Species reactivity: Human, Purity: >95% SDS-PAGE, Molecular Characterization: Fused with 6xHis tag at the C-terminus, Molecular weight of 25 kDa, Synonym: AZU1, Azurocidin, HBP, AZAMP, AZU, Size: 1mg

Image Unavailable-103012-950

Human Recombinant FABP2 (from E. coli)

Supplier: ACROBIOSYSTEMS
Description: FABP2/I-FABP Protein, Host: E.coli, Species reactivity: Human, Purity: >95% SDS-PAGE, Molecular Characterization: His Tag is fused with a polyhistidine tag at N-terminus, Molecular weight 16 kDa, Endotoxin: <1.0 EU per ug, Synonym: FABP2, FABPI, Size: 1mg

Image Unavailable-103012-790

Human Recombinant DPP4 (from HEK293 Cells)

Supplier: ACROBIOSYSTEMS
Description: Human DPPIV/CD26 Protein, Tag Free, Host: HEK293 cells, Species Reactivity: Human, purity: >95% SDS-PAGE, Molecular Characterization: MW of 85.4 kDa, N-terminus, Synonym: DPP4,ADABP,ADCP2,CD26,DPPIV,TP103, Storage: 4 Degree C, size: 1mg

Image Unavailable-103013-538

Human Recombinant BACE1 (from HEK293 cells)

Supplier: ACROBIOSYSTEMS
Description: BACE-1 Protein, Tag Free, Host: HEK293 cells, Species Reactivity: Human, Purity: >98% (SDS-PAGE), Molecular Characterization: Tag Free, with calculated MW of of 49 KDa, Synonyms: BACE1,ASP2,BACE,FLJ90568,HSPC104,KIAA1149,Memapsin-2, Storage: 4 deg C, Size: 100ug

Image Unavailable-103007-364

Mouse;Rat Beta-Amyloid (1-38)

Catalog Number: (103007-364)
Supplier: Anaspec Inc
Description: This is amino acids 1 to 38 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid by three amino acid residues: Arg5, Tyr10, and His13 residues in human beta-amyloid correspond to Gly5, Phe10, and Arg13 in mice and rat sequence.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGG
Molecular Weight: 4035.5 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-102996-486

Human Beta-Amyloid (1-28)

Supplier: Anaspec Inc
Description: Aß (1-28) is highly hydrophilic and shares sequences with bA4, the major component of Aß. Its assembly is fibrillar, i.e., elongated in a single direction. Reports show that synthetic peptides Aß (1-40) and Aß (1-28) have significant effects on normal human plasma cholesterol esterification rate.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNK
Molecular Weight: 3262.5 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Image Unavailable-102999-606

Human Cys-beta-Amyloid (1-40)

Catalog Number: (102999-606)
Supplier: Anaspec Inc
Description: Aß (1-40) together with Aß (1-42) are two major C-terminal variants of the Aß protein constituting the majority of Aßs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. This Cys-containing mutant can be used as a model for aggregation studies.
Sequence: CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4433 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Product Image-10128-494

Potassium chloride 1 M in aqueous solution, sterile filtered

Catalog Number: (10128-494)
Supplier: QUALITY BIOLOGICAL, INC.
Description: Potassium Chloride 1 M is used to establish a constant ionic strength in a sample solution.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Image Unavailable-103006-544

Human [Gly22]-beta-Amyloid (1-40)

Catalog Number: (103006-544)
Supplier: Anaspec Inc
Description: Several mutations within the β-amyloid precursor gene cause early onset familial Alzheimer's disease, and were shown to promote Aβ aggregation. In the arctic mutant, Glu 22 is replaced with Gly, resulting primarily in increased formation of Aβ protofibrils.
Sequence: DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVV
Molecular Weight: 4257.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103007-272

Bim BH3, Peptide IV

Catalog Number: (103007-272)
Supplier: Anaspec Inc
Description: This Bim peptide belongs to the pro-apoptotic group of the Bcl-2 family of proteins.
Sequence:DMRPEIWIAQELRRIGDEFNAYYARR
MW:3269.7 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103008-028

Histone H3 (23-34)

Catalog Number: (103008-028)
Supplier: Anaspec Inc
Description: This peptide is Histone H3 amino acid residues 23 to 34.
Sequence:KAARKSAPATGG
MW:1114.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
689 - 704 of 377,185
no targeter for Bottom