You Searched For: Molecular+Bioproducts+Inc.


377,185  results were found

SearchResultCount:"377185"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (103007-272)
Supplier: Anaspec Inc
Description: This Bim peptide belongs to the pro-apoptotic group of the Bcl-2 family of proteins.
Sequence:DMRPEIWIAQELRRIGDEFNAYYARR
MW:3269.7 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103008-028)
Supplier: Anaspec Inc
Description: This peptide is Histone H3 amino acid residues 23 to 34.
Sequence:KAARKSAPATGG
MW:1114.3 Da
% peak area by HPLC:95
Storage condition:-20° C


Supplier: ACROBIOSYSTEMS
Description: GPA33/A33 Protein, Host: HEK293 Cells, Species reactivity: Mouse, Purity: >95% as determined by SDS-PAGE, Molecular Characterization: His Tag is Fused with a polyhistidine tag at the C-terminus, Molecular weight of 24.7 kDa, Synonym: GPA33, A33, Size: 50ug

Catalog Number: (103003-038)
Supplier: Anaspec Inc
Description: Purified metalloendopeptidase cleaves the Gly33-Leu34 bond of Alzheimer Aß (1-40) peptide producing soluble 1-33 and 34-40 fragments of Aß (1-40) without any neurotoxic effects.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG
Molecular Weight: 3674 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (103007-352)
Supplier: Anaspec Inc
Description: This is amino acids 22 to 41 fragment of beta-amyloid peptide, biotinylated through an LC spacer at the N-terminus.
Sequence: Biotin-LC-EDVGSNKGAIIGLMVGGVVI
Molecular Weight: 2267.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Supplier: Cambridge Isotope Labs Inc
Description: Dimethyl Sulfoxide-D6, (D 99.9% PCT), Purity: 99.5%, Cas number: 67-68-5, Molecular formula: CD3SOCD3, Molecular weight: 84.17, Appearance: Clear liquid, Size: 100g

Catalog Number: (BDH3042-2.5LP)
Supplier: BDH
Description: VWR* Hydrofluoric Acid, 48%, ACS Grade, Molecular formula: HF, Molecular weight: 20.01, CAS: 7664-39-3, density: 1.17kg/L, Size: 2.5L PPQ poly bottle.

Catalog Number: (75842-526)
Supplier: BIOGEMS INTERNATIONAL INC.
Description: The MTS510 monoclonal antibody specifically reacts with the Toll-Like Receptor 4 (TLR-4) and MD-2 (LY96) molecular complex. The complex of TLR-4, MD-2, and CD14 regulates the innate immune system recognition of bacterial lipopolysaccharides (LPS) and is expressed on the surface of thioglycollate-elicited macrophages. The epitope that binds the MTS510 antibody is lost after LPS stimulation and the antibody can be used to co-immunoprecipitates MD-2 and TLR4.


Supplier: Anaspec Inc
Description: HiLyte™ Fluor 488 acid, SE is an excellent amine-reactive fluorescent labeling dye that generates the protein conjugates far superior to those of fluorescein derivatives such as FITC.

Supplier: ACROBIOSYSTEMS
Description: RENIN Protein, Host: HEK293, Species Reactivity: Human, Purity: >95% by SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at the C-terminus, calculated MW of 43.2 kDa, Synonym: REN,FLJ10761,Renin,angiotensinogenase, Storage: 4 degree Celcius, Size: 100ug

Catalog Number: (103010-208)
Supplier: Anaspec Inc
Description: Oxonol VI is used as an optical indicator for membrane potentials in lipid vesicles. Oxonol VI is a sensitive slow-response membrane potential probe whose magnitude of optical response is much larger than that of faster response probes (Oxonol V). The fluorescence of Oxonol VI decreases upon membrane hyperpolarization. In general, slow response probes are suitable for detecting changes in average membrane potentials of nonexcitable cells caused by respiratory activity, ion-channel permeability, drug binding and other factors.


Supplier: ACROBIOSYSTEMS
Description: PE-Labeled PD-1 PDCD1 Protein, Fc Tag, Recombinant, Source: HEK293, Species: human, Molecular weight: 44.7 kDa, Synonyms: DCD1, PD1, CD279, SLEB2, Size: 250 test

Supplier: ACROBIOSYSTEMS
Description: Azurocidin/CAP37/AZU1 Protein, Host: HEK293 Cells, Species reactivity: Human, Purity: >95% SDS-PAGE, Molecular Characterization: Fused with 6xHis tag at the C-terminus, Molecular weight of 25 kDa, Synonym: AZU1, Azurocidin, HBP, AZAMP, AZU, Size: 1mg

Supplier: ACROBIOSYSTEMS
Description: FABP2/I-FABP Protein, Host: E.coli, Species reactivity: Human, Purity: >95% SDS-PAGE, Molecular Characterization: His Tag is fused with a polyhistidine tag at N-terminus, Molecular weight 16 kDa, Endotoxin: <1.0 EU per ug, Synonym: FABP2, FABPI, Size: 1mg

Supplier: ACROBIOSYSTEMS
Description: Human Glypican 2 / GPC2 Protein, His Tag, ACROBiosystems

Supplier: Innovative Research Inc
Description: Factor IX Monoclonal antibody, Clone: 9042, Host: Rat, Species: Mouse, Target Molecular weight: 56 Kda, Antigen: Full length native protein (purified) (Mouse), Application: ELISA, Western Blot, Purity: IgG fraction, Form: Liquid, Storage: -20 deg C, Size: 0.1mg

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
no targeter for Bottom