Print…

You Searched For: Molecular+Bioproducts+Inc.


485,990  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"485990"

Rate These Search Results

Image Unavailable-102996-340

GRGDTP 5 mg

Description: GRGDTP, Purity: HPLC >/= to 95%, Molecular Weight: 601.6, Sequence: H-Gly-Arg-Gly-Asp-Thr-Pro-OH, Appearance: White Powder, This is an integrin-binding peptide, Storage: -20 deg C, Size: 5 mg
Catalog Number: 102996-340
Supplier: Anaspec Inc
Image Unavailable-100200-970

2,6-Diisopropylphenylimido neophylidene (R)-(+)-BIPHEN molybdenum (VI)

Description: 2,6-Diisopropylphenylimido neophylidene (R)-(+)-BIPHEN molybdenum (VI), purity: Min 97%, CAS number: 329735-77-5, molecular Formula: C46H61MoNO2, Color: red, Form: crystalline, Size: 0.1g
Catalog Number: 100200-970
Supplier: Strem Chemicals Inc
Image Unavailable-101175-844

PBS

Description: 10X Solution, pH 7.4, 5 L
Catalog Number: 101175-844
Supplier: Thermo Fisher Scientific Chemicals Inc.
Image Unavailable-103003-178

Beta-Amyloid (1-40) 0.1 mg

Description: Beta-Amyloid (1-40), Purity: HPLC >/- 95%, Molecular Weight: 4686.3, Sequence: HiLyte* Fluor 488-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, label: HiLyte* Fluor 488, Appearance: Lyophilized orange powder, this is a fluorescent labeled B-Amyloid peptide, Size: 0.1 mg
Catalog Number: 103003-178
Supplier: Anaspec Inc
Image Unavailable-103010-958

HiLyte* Fluor 594 acid, SE 5 mg

Description: HiLyte* Fluor 594 acid, SE, Synonym: HiLyte* Fluor 594 acid, NHS ester, an alternative to Alexa Fluor* 594 and DyLight Fluor* 594, Molecular Weight 848.94, Spectral Properties: Abs/Em = 593/616 nm, Solvent System: DMF/DMSO, Storage: -20 deg C, Form: Solid, Size: 5 mg
Catalog Number: 103010-958
Supplier: Anaspec Inc
Product Image-76437-204

Centrifuge Tube, Graduated, Conical Base, Bulk, Sterile, High-clarity, medical-grade polymer, Graduations every 5 mL increments, Rated to 17,000 x G, Temperature range: -80 deg to 40 deg C, For use in medical, pharmaceutical and food industry, and molecular biology, Size: 15 mL

Description: Centrifuge Tube, Graduated, Conical Base, Bulk, Sterile, High-clarity, medical-grade polymer, Graduations every 5 mL increments, Rated to 17,000 x G, Temperature range: -80 deg to 40 deg C, For use in medical, pharmaceutical and food industry, and molecular biology, Size: 15 mL
Catalog Number: 76437-204
Supplier: SCIENTIFIC SPECIALTIES, INC.
Product Image-76437-206

Centrifuge Tube, Graduated, Conical Base, Racked, Sterile, High-clarity, medical-grade polymer, Graduations every 5 mL increments, Rated to 17,000 x G, Temperature range: -80 deg to 40 deg C, For use in medical, pharmaceutical and food industry, and molecular biology, Size: 15 mL

Description: Centrifuge Tube, Graduated, Conical Base, Racked, Sterile, High-clarity, medical-grade polymer, Graduations every 5 mL increments, Rated to 17,000 x G, Temperature range: -80 deg to 40 deg C, For use in medical, pharmaceutical and food industry, and molecular biology, Size: 15 mL
Catalog Number: 76437-206
Supplier: SCIENTIFIC SPECIALTIES, INC.
Product Image-76437-210

Centrifuge Tube, Graduated, Conical Base, Racked, Sterile, High-clarity, medical-grade polymer, Graduations every 5 mL increments, Rated to 17,000 x G, Temperature range: -80 deg to 40 deg C, For use in medical, pharmaceutical and food industry, and molecular biology, Size: 50 mL

Description: Centrifuge Tube, Graduated, Conical Base, Racked, Sterile, High-clarity, medical-grade polymer, Graduations every 5 mL increments, Rated to 17,000 x G, Temperature range: -80 deg to 40 deg C, For use in medical, pharmaceutical and food industry, and molecular biology, Size: 50 mL
Catalog Number: 76437-210
Supplier: SCIENTIFIC SPECIALTIES, INC.
Product Image-76437-208

Centrifuge Tube, Graduated, Conical Base, Bulk, Sterile, High-clarity, medical-grade polymer, Graduations every 5 mL increments, Rated to 17,000 x G, Temperature range: -80 deg to 40 deg C, For use in medical, pharmaceutical and food industry, and molecular biology, Size: 50 mL

Description: Centrifuge Tube, Graduated, Conical Base, Bulk, Sterile, High-clarity, medical-grade polymer, Graduations every 5 mL increments, Rated to 17,000 x G, Temperature range: -80 deg to 40 deg C, For use in medical, pharmaceutical and food industry, and molecular biology, Size: 50 mL
Catalog Number: 76437-208
Supplier: SCIENTIFIC SPECIALTIES, INC.
Image Unavailable-103011-276

DiSC3(5) 100 mg

Description: DiSC3(5), Synonym: 3,3'-Dipropylthiadicarbocyanine iodide, Accumulate in cells on hyperpolarized membranes, Molecular Weight: 546.5, Spectral Properties: Abs/Em = 651/675 nm, Solvent System: DMSO, CAS number: 53213-94-8, Molecular formula: C25H27IN2S2, Storage -20C, Size: 100 mg
Catalog Number: 103011-276
Supplier: Anaspec Inc
Image Unavailable-100200-974

2,6-Diisopropylphenylimido neophylidene (S)-(-)-BIPHEN molybdenum (VI)

Description: 2,6-Diisopropylphenylimido neophylidene (S)-(-)-BIPHEN molybdenum (VI), purity: Min 97%, CAS number: 205815-80-1, molecular Formula: C46H61MoNO2, Color: red, Form: crystalline, Size: 0.1g
Catalog Number: 100200-974
Supplier: Strem Chemicals Inc
Image Unavailable-103386-520

Immobilized Trypsin 15ml

Description: Immobilized Trypsin, Source: Bovine pancreas, Species: Bovine, Purity: >95% by SDS-PAGE analysis, Form: Resin, Molecular Weight: 23300, Buffer: 0.02% NaN3 50% Glycerol, cleaves peptide bonds at Arg and Lys, for digestions of proteins & peptides, Storage: 4 C, Size: 15ml
Catalog Number: 103386-520
Supplier: Innovative Research Inc
Image Unavailable-102999-350

Beta - Amyloid (22 - 35), Human, mouse/rat 1 mg

Description: Beta - Amyloid (22 - 35), Human, mouse/rat, Sequence: EDVGSNKGAIIGLM, Purity: HPLC greater than or equal to 95%, Molecular Weight: 1403.6, Storage: -20 deg C, Size: 1 mg
Catalog Number: 102999-350
Supplier: Anaspec Inc
Image Unavailable-102999-346

Beta - Amyloid (40 - 1), Human 1mg

Description: Beta - Amyloid (40 - 1), Human, Purity: Peak Area By HPLC greater than or equal to 95%, Molecular Weight: 4329.9, Peptide Reconstitution: B-Amyloid (40-1) peptide is freely soluble in DMSO, Storage: –20 deg C or lower, Size: 1mg
Catalog Number: 102999-346
Supplier: Anaspec Inc
Image Unavailable-103007-346

Beta - Amyloid (17 - 28) 1 mg

Description: Beta - Amyloid (17 - 28), Human, mouse/rat, Sequence: LVFFAEDVGSNK, This peptide is amino acids 17 to 28 fragment of beta-amyloid, Molecular Weight: 1325.5, Apperance: Powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-346
Supplier: Anaspec Inc
Image Unavailable-76303-770

Recom Hek293 Md-2/Ly96 >/= 90% Human 1Mg

Description: MD-2/LY96 Recombinant, Purity: greater than or equal to 90% by SDS-PAGE gel and HPLC, Source: HEK293 cells, Reactivity: Human, Molecular weight of 17.2 kDa, Synonyms: Myeloid differentiation protein-2, Lymphocyte antigen 96, ESPO-1, Size: 1 mg
Catalog Number: 76303-770
Supplier: PeproTech, Inc.
609 - 624 of 485,990