Print…

You Searched For: ACS Scientific Inc


485,990  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"485990"

Rate These Search Results

Image Unavailable-103002-976

Beta-Amyloid (5-42) 1mg

Description: Beta-Amyloid (5-42), Human, Purity: Greater than or equal to 95%( % Peak Area By HPLC), Molecular weight: 4051.6, Sequence: RHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA (One-Letter Code), Storage: At -20 Degree C, Size: 1mg
Catalog Number: 103002-976
Supplier: Anaspec Inc
Image Unavailable-103002-974

Beta-Amyloid (5-42) 0.1mg

Description: Beta-Amyloid (5-42), Human, Purity: Greater than or equal to 95%( % Peak Area By HPLC), Molecular weight: 4051.6, Sequence: RHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA (One-Letter Code), Storage: At -20 Degree C, Size: 0.1mg
Catalog Number: 103002-974
Supplier: Anaspec Inc
Image Unavailable-102996-722

Scrambled-beta-Amyloid (1-42) 0.5 mg

Description: Scrambled-beta-Amyloid (1-42), Human, Purity: HPLC >/= 95%, Molecular Weight: 4514.1, Sequence: AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA, Appearance: White Powder, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102996-722
Supplier: Anaspec Inc
Image Unavailable-102978-552

Palladium Bisdibenzylideneacetone

Description: Palladium Bisdibenzylideneacetone, CAS Number: 32005-36-0, Molecular Formula: C34H28O2Pd, Formula Weight: 575.00, Color and Form: purple powder, Stability: air sensitive, moisture sensitive
Catalog Number: 102978-552
Supplier: Strem Chemicals Inc
Image Unavailable-103010-840

6 - TAMRA, Special Formulation 10 mg

Description: 6 - TAMRA, Special Formulation, purified single isomer, Synonym: 6-Carboxytetramethylrhodamine, Molecular Weight: 430.45 (Free Acid), Spectral Properties: Abs/Em = 541/568 nm, Solvent System: DMF or DMSO, Storage -20 degree C, Size: 10 mg
Catalog Number: 103010-840
Supplier: Anaspec Inc
Image Unavailable-101173-306

Guanidine, Hydrochloride

Description: 100 gm
Catalog Number: 101173-306
Supplier: Thermo Fisher Scientific Chemicals Inc.
Image Unavailable-101171-414

Guanidine, Hydrochloride

Description: 500 gm
Catalog Number: 101171-414
Supplier: Thermo Fisher Scientific Chemicals Inc.
Image Unavailable-75991-570

Siliabond* Amine(Si-NH2) 50G

Description: Siliabond* Amine(Si-NH2) Silicagel, Effective scavenger, Array: AQ C18, Endcapped, Typical Tap density: 700 g/L, Molecular Loading: 1.20 mmol/g, Color: Orange, Particle Size: 40-63 um / 230-400 mesh, Pore size: 60 Angstrom, Storage: <8 deg C, Size: 50G
Catalog Number: 75991-570
Supplier: SILICYCLE INC.
Image Unavailable-75991-568

Siliabond* Amine(Si-NH2) 500G

Description: Siliabond* Amine(Si-NH2) Silicagel, Effective scavenger, Array: AQ C18, Endcapped, Typical Tap density: 700 g/L, Molecular Loading: 1.20 mmol/g, Color: Orange, Particle Size: 40-63 um / 230-400 mesh, Pore size: 60 Angstrom, Storage: <8 deg C, Size: 500G
Catalog Number: 75991-568
Supplier: SILICYCLE INC.
Image Unavailable-75991-558

Siliabond* Amine(Si-NH2) 100G

Description: Siliabond* Amine(Si-NH2) Silicagel, Effective scavenger, Array: AQ C18, Endcapped, Typical Tap density: 700 g/L, Molecular Loading: 1.20 mmol/g, Color: Orange, Particle Size: 40-63 um / 230-400 mesh, Pore size: 60 Angstrom, Storage: <8 deg C, Size: 100G
Catalog Number: 75991-558
Supplier: SILICYCLE INC.
Image Unavailable-75991-562

Siliabond* Amine(Si-NH2) 1KG

Description: Siliabond* Amine(Si-NH2) Silicagel, Effective scavenger, Array: AQ C18, Endcapped, Typical Tap density: 700 g/L, Molecular Loading: 1.20 mmol/g, Color: Orange, Particle Size: 40-63 um / 230-400 mesh, Pore size: 60 Angstrom, Storage: <8 deg C, Size: 1KG
Catalog Number: 75991-562
Supplier: SILICYCLE INC.
Image Unavailable-75991-564

Siliabond* Amine(Si-NH2) 250G

Description: Siliabond* Amine(Si-NH2) Silicagel, Effective scavenger, Array: AQ C18, Endcapped, Typical Tap density: 700 g/L, Molecular Loading: 1.20 mmol/g, Color: Orange, Particle Size: 40-63 um / 230-400 mesh, Pore size: 60 Angstrom, Storage: <8 deg C, Size: 250G
Catalog Number: 75991-564
Supplier: SILICYCLE INC.
Image Unavailable-100200-970

2,6-Diisopropylphenylimido neophylidene (R)-(+)-BIPHEN molybdenum (VI)

Description: 2,6-Diisopropylphenylimido neophylidene (R)-(+)-BIPHEN molybdenum (VI), purity: Min 97%, CAS number: 329735-77-5, molecular Formula: C46H61MoNO2, Color: red, Form: crystalline, Size: 0.1g
Catalog Number: 100200-970
Supplier: Strem Chemicals Inc
Product Image-470305-406

BioSigns Red Blood Cell Model

Description: BioSigns Red Blood Cell Model, Learn all of this and so much more with this hands-on interactive 4-piece model that provides magnified and cross-sectioned detailing of a Red Blood Cell, Develop dexterity, enhance fine motor skills and inspire critical thought
Catalog Number: 470305-406
Supplier: Tedco
Image Unavailable-76177-610

Carbapenem-resistant enterobacteriaceae (CRE) Control Panel (Inactivated Swab)

Description: Carbapenem-resistant enterobacteriaceae (CRE) Control Panel (Inactivated Swab)
Catalog Number: 76177-610
Supplier: MICROBIOLOGICS, INC.
Product Image-AGCP8828

VF-23MS 60M X 032MM X 015UM

Catalog Number: AGCP8828
Supplier: AGILENT TECHNOLOGIES, INC (CSD)
657 - 672 of 485,990