Print…

You Searched For: Molecular+Bioproducts+Inc.


377,029  results were found

Refine Results Sort by
SearchResultCount:"377029"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-103387-016

Anti-IGHG1 Human Antibody

Supplier: Innovative Research Inc
Description: IgG1, Human Plasma, Purity: >95% by SDS-PAGE analysis, Source: Human plasma, Molecular Weight: 150,000, Species: Human, Storage: -70 C, Form: Lyophilized powder, Preservative: Sodium Azide, Concentration: 1.0 mg/mlSample Volume 1.0 ml, Size: 1mg

Image Unavailable-100211-084

Dichloro[(R)-(-)-4,12-bis(di(3,5-xylyl)phosphino)-[2.2]-paracyclophane][(1S,2S)-(-)-1,2-diphenylethylenediamine]ruthenium(II) ≥95%

Supplier: Strem Chemicals Inc
Description: PHANEPHOS

Image Unavailable-103386-058

Anti-F2 Sheep Polyclonal Antibody

Supplier: Innovative Research Inc
Description: Prothrombin Polyclonal antibody, Host: Sheep, Species: Mouse, Isotype: IgG, Molecular weight: 72KDa, Antigen: Full length native protein (purified) (Mouse), Application: ELISA, Western blot, Purity: Serum, Form: Frozen liquid, Storage: -70 deg C, Size: 10ml

Image Unavailable-103007-358

Human Beta-Amyloid (1-28)-Lys(Biotin)-NH2, Biotin

Catalog Number: (103007-358)
Supplier: Anaspec Inc
Description: This is amino acids 1 to 28 fragment of the b-amyloid peptide biotinylated on the side chain of lysine.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNK-K(Biotin)-NH2
Molecular Weight: 3616 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-102999-348

Human Beta-Amyloid (1-11)

Catalog Number: (102999-348)
Supplier: Anaspec Inc
Description: Anionic interaction of Aß(1-11) with Factor XII is suspected to cause the massive activation of the C4 (Complement 4) system in cerebrospinal fluid of Alzheimer’s disease patients.
Sequence: DAEFRHDSGYE
Molecular Weight: 1325.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103010-638

AggreSure™ Human Beta-Amyloid (1-40)

Catalog Number: (103010-638)
Supplier: Anaspec Inc
Description: AnaSpec's AggreSure™ beta-Amyloid (1-40) peptide is pretreated and tested for aggregation using AnaSpec's SensoLyte® ThT Aβ40 Aggregation kit (Cat# AS-72213).
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4329.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103008-216

Human [Met]-beta-Amyloid (1-42), TAMRA (5-Carboxytetramethylrhodamin)

Catalog Number: (103008-216)
Supplier: Anaspec Inc
Description: This is b-amyloid (1-42) peptide with an N-terminal methionine is labeled with a fluorescent dye, 5-TAMRA (Ex/Em= 544/572 nm), on the N-terminus.
Sequence: 5-TAMRA-MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 5057.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103007-546

Human;Mouse;Rat Biotin-LC-Beta-Amyloid (15-25), Biotin

Catalog Number: (103007-546)
Supplier: Anaspec Inc
Description: This is a biotinylated fragment of the human, mouse, rat ß-amyloid (15-25).
Sequence: Biotin-LC-QKLVFFAEDVG
Molecular Weight: 1591.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103006-992

Human Beta-Amyloid (1-34)

Catalog Number: (103006-992)
Supplier: Anaspec Inc
Description: Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42. Additional minor Aβ peptides are also normally produced, such as Beta-amyloid 1-34, 1-37, 1-38 and 1-39, and few reports have quantified the levels of these peptides in the brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL
Molecular Weight: 3787.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103010-774

5-Carboxyfluorescein-N-succinimidyl ester (5-FAM SE)

Supplier: Anaspec Inc
Description: 5-FAM, SE is a single isomer. It is one of the most popular green fluorescent reagents used for labeling peptides, proteins and nucleotides. It has also been used to prepare various small fluorescent molecules.

Image Unavailable-103003-094

PKG Substrate

Supplier: Anaspec Inc
Description: RKRSRAE is a selective substrate for protein kinase G (PKG) with a strong preference for PKG Iα (Km = 59 µM) over PKG II (Km = 305 µM).
Sequence:RKRSRAE
MW:902 Da
% peak area by HPLC:95
Storage condition:-20° C

Image Unavailable-102995-174

(4R)-4-i-Propyl-1,2,3-oxathiazolidine-2,2-dioxide-3-carboxylic acid t-butyl ester ≥97%

Catalog Number: (102995-174)
Supplier: Strem Chemicals Inc
Description: (4R)-4-i-Propyl-1,2,3-oxathiazolidine-2,2-dioxide-3-carboxylic acid t-butyl ester, minimum 97%, Molecular Formula: C10H19NO5S, Color and Form: white solid, Formula Weight: 265.33, Size: 1kg
Product Image-76480-994

5-(2-Aminoethylamino)-1-naphthalenesulfonic acid ≥95%

Catalog Number: (76480-994)
Supplier: AAT BIOQUEST INC
Description: EDANS is one of the most popular donors for developing FRET-based nucleic acid probes (such as Molecular Beacons) and protease substrates.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Image Unavailable-103007-732

SAM PEP 1 Peptide, FAM (Carboxyfluorescein)

Catalog Number: (103007-732)
Supplier: Anaspec Inc
Description: This FAM labeled peptide (Abs/Em = 494/521 nm) can be used as a substrate for 5-AMP-activated protein kinase (AMPK) in in vitro kinase assays.
Sequence:5-FAM-HMRSAMSGLHLVKRR
MW:2137.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103388-370

Anti-F10 Rat Monoclonal Antibody [clone: 9051]

Supplier: Innovative Research Inc
Description: Factor X Monoclonal antibody, Clone: 9051, Host: Rat, Species: Mouse, Target Molecular weight: 58900, Antigen: Full length native protein (purified) (Mouse), Application: ELISA, Western Blot, Purity: IgG fraction, Form: Liquid, Storage: -20 deg C, Size: 0.1mg

Image Unavailable-103387-604

Anti-PLG Sheep Polyclonal Antibody

Supplier: Innovative Research Inc
Description: Plasminogen Polyclonal antibody, Host: Sheep, Species: Human, Isotype: IgG, Molecular weight: 92 Kda, Antigen: Full length native protein (purified) (Human), Application: ELISA, Western blot, Purity: Serum, Form: Frozen liquid, Storage: -70 deg C, Size: 1ml

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
481 - 496 of 377,029
no targeter for Bottom