You Searched For: Molecular+Bioproducts+Inc.


377,029  results were found

SearchResultCount:"377029"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (103007-358)
Supplier: Anaspec Inc
Description: This is amino acids 1 to 28 fragment of the b-amyloid peptide biotinylated on the side chain of lysine.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNK-K(Biotin)-NH2
Molecular Weight: 3616 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Supplier: Strem Chemicals Inc
Description: [P,P'-1,3-bis(di-i-propylphosphino)propane][P-1,3-bis(di-i-propylphosphino)propane]palladium (0),purity: Min 98%, CAS number: 123333-45-9, molecular Formula: C30H68P4Pd, Color: yellow, Form: oil to solid, Size: 1g

Supplier: Innovative Research Inc
Description: IgG, Fc Fragment, Human Plasma, Purity: >95% by SDS-PAGE analysis, Source: Human plasma, Molecular Weight: 31,000, Species: Human, Storage: -70 C, Form: Frozen liquid, Preservative: Sodium Azide, Concentration: 1.0 mg/ml, Size: 5mg

Supplier: Innovative Research Inc
Description: IgM, Human Myeloma Plasma, Purity: >95% by SDS-PAGE analysis, Source: Human myeloma plasma, Molecular Weight: 950,000, Species: Human, Storage: -70 C, Form: Frozen liquid, Preservative: Sodium Azide, Concentration: 1.0 mg/ml, Size: 5mg

Supplier: QUALITY BIOLOGICAL, INC.
Description: Sodium Chloride, 5M is suitable for molecular biology, protein chemistry and biochemical applications.

Small Business Enterprise Minority or Woman-Owned Business Enterprise

Supplier: Innovative Research Inc
Description: Protein G Polyclonal antibody, Host: Sheep, Species Reactivity: Sheep, Isotype: IgG, Molecular weight: 160000, Extinction Coefficient: 1.36, pH: 7.4, Application: ELISA, Western Blot, Purity: IgG fraction, Form: Frozen liquid, Storage: -70 deg C, Size: 50MG

Supplier: Innovative Research Inc
Description: Protein G Polyclonal antibody, Host: Porcine, Species Reactivity: Swine, Isotype: IgG, Molecular weight: 160000, Extinction Coefficient: 1.36, pH: 7.4, Application: ELISA, Western Blot, Purity: IgG fraction, Form: Frozen liquid, Storage: -70 deg C, Size: 1g

Supplier: Strem Chemicals Inc
Description: JOSIPHOS, Phosphine

Catalog Number: (103008-484)
Supplier: Anaspec Inc
Description: This peptide is Histone H2A (1-20) with a C-terminal GG linker followed by a biotinylated lysine.
Sequence:SGRGKQGGKARAKAKTRSSR-GGK(Biotin)
MW:2556 Da
% peak area by HPLC:95
Storage condition:-20° C


Supplier: Strem Chemicals Inc
Description: BPE, DUPHOS

Catalog Number: (103008-022)
Supplier: Anaspec Inc
Description: This peptide is Histone H3 amino acid residues 1 to 10 mono-methylated at Lys-9.
Sequence:TKQTAR-K(Me1)-STGGKAPR
MW:1600.8 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103005-924)
Supplier: Anaspec Inc
Description: This synthetic peptide mimics wild-type AH (amphipathic helix) and inhibits membrane association of NS5A, hence impairing HCV replication.
Sequence:SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD-NH2
MW:3805.3 Da
% peak area by HPLC:95
Storage condition:-20° C


Supplier: Innovative Research Inc
Description: Factor VII Monoclonal antibody, Clone: 9031, Host: Rat, Species: Mouse, Target Molecular weight: 50 KDa, Antigen: Full length native protein (purified) (Mouse), Application: ELISA, Western Blot, Purity: IgG fraction, Storage: -20 deg C, Size: 0.1mg

Supplier: Innovative Research Inc
Description: Factor X Monoclonal antibody, Clone: 9051, Host: Rat, Species: Mouse, Target Molecular weight: 58900, Antigen: Full length native protein (purified) (Mouse), Application: ELISA, Western Blot, Purity: IgG fraction, Form: Liquid, Storage: -20 deg C, Size: 0.1mg

Supplier: Innovative Research Inc
Description: Plasminogen Polyclonal antibody, Host: Sheep, Species: Human, Isotype: IgG, Molecular weight: 92 Kda, Antigen: Full length native protein (purified) (Human), Application: ELISA, Western blot, Purity: Serum, Form: Frozen liquid, Storage: -70 deg C, Size: 1ml

Supplier: Innovative Research Inc
Description: CTnT Polyclonal antibody, Host: Sheep, Species Reactivity: Human, Isotype: IgG, Molecular weight: 36KDa, Antigen: Full length native protein (purified) (Human), Application: ELISA, Western Blot, Purity: Serum, Form: Frozen liquid, Storage: -70 degree C, Size: 1ml

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
no targeter for Bottom