You Searched For: Molecular+Bioproducts+Inc.


377,300  results were found

SearchResultCount:"377300"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (103679-350)
Supplier: Sino Biological
Description: BMPR1B, Recombinant protein, Purity: > 90 % as determined by SDS-PAGE, Host: Baculovirus-Insect Cells, Species: Human, Molecular Mass: human ALK6 (149-502)/GST chimera consists of 591 amino acids and has a calculated molecular mass of 68.3 kDa, Size: 50 ug


Supplier: TCI America
Description: CAS Number: 66-97-7 MDL Number: MFCD00010520 Molecular Formula: C11H6O3 Molecular Weight: 186.17 Purity/Analysis Method: <gt/>99.0% (GC) Melting point (°C): 163 Storage Temperature: 0-10°C
Supplier: TCI America
Description: CAS Number: 843-55-0 MDL Number: MFCD00019341 Molecular Formula: C18H20O2 Molecular Weight: 268.36 Purity/Analysis Method: <gt/>98.0% (GC) Form: Crystal Melting point (°C): 189 Flash Point (°C): 246
Catalog Number: (TCN0950-5MG)
Supplier: TCI America
Description: Neu5AcA(2-6)GalB(1-4)GlcNAc-B-ethylamine, Purity: >98.0%(HPLC), Molecular Formula: C27H46N3NaO19, Molecular Weight: 739.66, Size: 5MG

Supplier: TCI America
Description: CAS Number: 5326-23-8 MDL Number: MFCD00006241 Molecular Formula: C6H4ClNO2 Molecular Weight: 157.55 Purity/Analysis Method: <gt/>98.0% (T) Form: Crystal

Supplier: TCI America
Description: 2,7-Dibromo-9-(4-bromophenyl)-9H-carbazole, Purity: >98.0%(HPLC), CAS number: 1313900-20-7, Molecular Formula: C18H10Br3N, Molecular Weight: 480, Form: Crystal - Powder, White - Slightly pale yellow, Size: 200MG

Supplier: TCI America
Description: 2,5-Dibromo-1,3-difluorobenzene, Purity: >98.0%(GC), CAS number: 128259-71-2, Molecular Formula: C6H2Br2F2, Molecular Weight: 271.89, Form: Crystal - Powder, Pale yellow - Grayish reddish yellow, Size: 1G

Catalog Number: (TCT3207-200MG)
Supplier: TCI America
Description: Tris(acetylacetonato)(1,10-phenanthroline)terbium(III), Purity: >98.0%(T), Cas number: 18078-86-9, Molecular Formula: C27H29N2O6Tb, Molecular Weight: 636.46, Appearance: White - Almost white solid crystal powder, Size: 200MG

SDS


Supplier: TCI America
Description: Cetraxate Hydrochloride, Purity: >98.0%(HPLC)(T), CAS Number: 27724-96-5, Molecular Formula: C17H23NO4.HCl, Molecular Weight: 341.83, Synonyms: 3-[4-[[trans-4-(Aminomethyl)cyclohexyl]carbonyloxy]phenyl]propanoic Acid Hydrochloride, Size: 50MG

Catalog Number: (TCC2645-5G)
Supplier: TCI America
Description: CAS Number: 352535-83-2 MDL Number: MFCD05664225 Molecular Formula: C6H5BClFO2 Molecular Weight: 174.36 Form: Crystal Color: White

SDS


Catalog Number: (TCC2741-25G)
Supplier: TCI America
Description: CAS Number: 2012-74-0 MDL Number: MFCD00037763 Molecular Formula: C11H13ClO2 Molecular Weight: 212.67 Purity/Analysis Method: <gt/>98.0% (T) Form: Crystal Melting point (°C): 89

SDS


Catalog Number: (TCD4383-1G)
Supplier: TCI America
Description: CAS Number: 879360-14-2 Molecular Formula: C12H18O4 Molecular Weight: 226.27 Purity/Analysis Method: <gt/>96.0% (GC,T) Form: Crystal

SDS


Catalog Number: (102998-454)
Supplier: Anaspec Inc
Description: A 32-amino acid long peptide with a disulfide bridge between Cys1 and Cys7 and C-terminal amidated Proline, Calcitonin (CT) is involved plasma calcium level. Compared to human or rat calcitonin, Salmon Calcitonin (sCT) is more potent in its biological actions such as inhibition of osteoclasts resorption of bones, renal ion excretion modulation, and others. The reason for its potency has been attributed to the fact that sCT forms an amphipathic helix in its amino acids 9-19 region.
Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: 1-7)
MW: 3431.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Supplier: ALKALI SCIENTIFIC MS
Description: Prepare electrophoresis buffers with CellPro™ TAE Tris acetate EDTA, ensuring molecular biology grade purity and sterile filtration.

Catalog Number: (103633-648)
Supplier: Sino Biological
Description: PRKAA1, Purity: > 94 % SDS-PAGE, Endotoxin: < 1.0 EU per ug of the protein, Host: Baculovirus-Insect Cells, Species: Human, Molecular mass: The recombinant heterotrimer of human AMPK has a calculated molecular mass of 160 KDa, Size: 20ug


Catalog Number: (TCB3826-5G)
Supplier: TCI America
Description: CAS Number: 6405-28-3 Molecular Formula: C13H17NO4 Molecular Weight: 251.28 Purity/Analysis Method: <gt/>98.0% (GC,T) Form: Crystal Melting point (°C): 159

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
4,081 - 4,096 of 377,300
no targeter for Bottom