Print…

You Searched For: NOVUS BIOLOGICALS INC MS


377,029  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"377029"

Rate These Search Results

Image Unavailable-102996-230

Human;Rat Neuropeptide Y

Description: Neuropeptide Y (NPY) is a 36aa neuropeptide involved in food intake, fat metabolism, stress and pain reduction, and vasodilation
Sequence:YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
MW:4271.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 102996-230
Supplier: Anaspec Inc
Image Unavailable-102997-266

Human Beta-Amyloid (2-40)

Description: This peptide is beta-amyloid (1-40) N-terminally truncated. It was shown that supplementing the media with N-terminally truncated Abeta (2-40) and (2-42) induce the phagocytosis of polystyrene particles by primary human monocytes. N-terminally truncated Aβ(x–42) induced the phagocytosis of PSPs significantly more effectively than did Aβ(x–40).
Sequence: AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4214.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Catalog Number: 102997-266
Supplier: Anaspec Inc
Image Unavailable-103007-866

Syk Kinase Peptide Substrate

Description: This synthetic peptide is a substrate for Syk kinase.
Sequence:KEDPDYEWPSAK-NH2
MW:1463.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103007-866
Supplier: Anaspec Inc
Image Unavailable-103003-536

Human Beta-Amyloid (1-40),Biotin

Description: Aß (1-40) together with Aß (1-42) are two major C-terminal variants of the Aß protein constituting the majority of Aßs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. This peptide is biotinylated at its N-terminus.
Catalog Number: 103003-536
Supplier: Anaspec Inc
Image Unavailable-103011-092

D-(-)-Luciferin free acid, Ultrapure

Description: Luminescent substrate for firefly luciferase.
Catalog Number: 103011-092
Supplier: Anaspec Inc
Image Unavailable-102998-174

UOM9

Description: This is a phosphorylated PKC substrate-3 peptide.
Sequence:KRP-pS-QRHGSKY-NH2
MW:1422.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 102998-174
Supplier: Anaspec Inc
Image Unavailable-102998-830

VSV VSV-G Peptide

Description: A vesicular stomatitis virus G (VSV-G) protein fragment.
Sequence:YTDIEMNRLGK
MW:1339.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 102998-830
Supplier: Anaspec Inc
Image Unavailable-103010-922

1-Pyrenebutanoic acid, succinimidyl ester

Description: 1-Pyrenebutanoic acid, SE is an UVexcitable amino-reactive fluorophore that is widely used to develop ratiometric fluorescent membrane probes. In general, pyrene fluorophores have concentration-dependent fluorescence due to the formation of excimer.
Catalog Number: 103010-922
Supplier: Anaspec Inc
Image Unavailable-103003-182

Human Beta-Amyloid (1-40), HiLyte™ Fluor 647

Description: This is a fluorescent (HiLyte™ Fluor 647)-labeled ß-Amyloid peptide, Abs/Em = 649/674 nm.
Catalog Number: 103003-182
Supplier: Anaspec Inc
Product Image-76480-514

Sulforhodamine 101 sodium salt ≥95%

Description: Sulforhodamine 101 is a fluorescence reference standard for measuring fluorescence quantum yield.
Catalog Number: 76480-514
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Product Image-76483-916

Screen Quest™ Membrane Potential Assay Kit, Red Fluorescence, AAT Bioquest

Description: Membrane potential is the difference in voltage between the interior and exterior of a cell.
Catalog Number: 76483-916
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Product Image-76620-558

VWR® DNA Ladders

Description: DNA ladders are supplied in a loading buffer that is ready to use on agarose and polyacrylamide DNA gels. The ladders are suitable with TBE, TAE, SB and LB electrophoresis systems.
Catalog Number: 76620-558
Supplier: VWR International
Image Unavailable-76485-594

6-NED azide fluorescent probe

Description: 5'-Labeled primer pairs include a fluorescently labeled oligo with a choice of dye on the 5' end, along with an unlabeled oligo, in each pair.
Catalog Number: 76485-594
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Image Unavailable-103006-916

Histone H3 (116–136)

Description: This peptide spans the C-terminus of histone H3, amino acids 116 to 136.
Sequence:KRVTIMPKDIQLARRIRGERA
MW:2508 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103006-916
Supplier: Anaspec Inc
Image Unavailable-103003-134

Crosstide Peptide, FAM (Carboxyfluorescein)

Description: Crosstide is a peptide analog of glycogen synthase kinase-3 (GSK-3) that functions as a natural substrate for Akt/PKB. It displays similar specificities towards PKBα, PKBβ and PKBγ isoforms. It is also recognized by MAPKAP kinase-1 and p70S6K. The fluorescent and biotinlyated peptides demonstrate similar enzyme activities.
Catalog Number: 103003-134
Supplier: Anaspec Inc
Image Unavailable-103007-108

Human Beta-Amyloid (1-40)-Lys(LC-biotin)-NH2, Biotin

Description: This is a 5-FAM labeled ß-?Amyloid (1-40). This amidated peptide is also biotinylated on the lysine side chain with 6-aminohexanoate (LC) as a spacer, Ex/Em=490 nm/ 520 nm.
Sequence: 5-FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(LC-BIOTIN)-NH2
Molecular Weight: 5154.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Catalog Number: 103007-108
Supplier: Anaspec Inc
545 - 560 of 377,029