Print…

You Searched For: Molecular+Bioproducts+Inc.


377,217  results were found

Refine Results Sort by
SearchResultCount:"377217"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-TCC3176-5G

4-Chloro-3-nitrobenzamide ≥98.0% (by GC)

Supplier: TCI America
Description: 4-Chloro-3-nitrobenzamide, Purity: >98.0%(GC), CAS Number: 16588-06-0, Molecular Formula: C7H5ClN2O3, Molecular Weight: 200.58, Size: 1G

Image Unavailable-TCB5407-1G

2-Bromo-5-dodecylthiophene ≥95.0% (by GC)

Supplier: TCI America
Description: 2-Bromo-5-dodecylthiophene, Purity: >95.0%(GC), CAS Number: 153561-74-1, Molecular Formula: C16H27BrS, Molecular Weight: 331.36, Size: 5G

Image Unavailable-TCB4839-1G

3-Bromo-5-chlorobenzaldehyde ≥98.0% (by GC)

Catalog Number: (TCB4839-1G)
Supplier: TCI America
Description: 3-Bromo-5-chlorobenzaldehyde, Purity: >98.0%(GC), CAS Number: 188813-05-0, Molecular Formula: C7H4BrClO, Molecular Weight: 219.46, Size: 1G
Image Unavailable-TCI0967-25G

2-Iodobiphenyl ≥98.0% (by GC)

Supplier: TCI America
Description: 2-Iodobiphenyl, Purity: >98.0%(GC), CAS Number: 2113-51-1, Molecular Formula: C12H9I, Molecular Weight: 280.11, Form: Liquid, Clear, Color: Slightly pale yellow - Yellow, Size: 5G

SDS Certificates

Image Unavailable-TCD4649-100G

Dimethyltin oxide ≥95.0% (W)

Supplier: TCI America
Description: Dimethyltin Oxide, Purity: >95.0%(W), CAS Number: 2273-45-2, Molecular Formula: C2H6OSn, Molecular Weight: 164.78, Form: Crystal-Powder, Solid, Color: White - Almost white, Size: 25G

SDS Certificates

Image Unavailable-TCC2723-5G

2-Chloro-4-formylpyridine ≥98.0% (by GC)

Supplier: TCI America
Description: CAS Number: 101066-61-9 MDL Number: MFCD06651557 Molecular Formula: C6H4ClNO Molecular Weight: 141.55 Purity/Analysis Method: <gt/>98.0% (GC) Form: Crystal Melting point (°C): 49 Flash Point (°C): 110

SDS Certificates

Image Unavailable-103007-462

NY-ESO-1 (87-111)

Catalog Number: (103007-462)
Supplier: Anaspec Inc
Description: This is amino acids 81 to 111 fragment of the NY-ESO-1. The NY-ESO-1 antigen is expressed by many tumors of different histological types (including breast, prostate, lung, and melanoma) and by male germline cells, but not by other normal tissues. NY-ESO-1 encodes MHC class I- and class II-restricted peptides expressed by a diverse range of cancers and recognized by T cells. This peptide is pan-MHC class II-restricted sequence that is capable of binding to multiple HLA-DR and HLA-DP4 molecules, including HLA-DRB1*0101, 0401, 0701, and 1101 and HLA-DPB1*0401 and 0402 molecules.
Sequence:LLEFYLAMPFATPMEAELARRSLAQ
MW:2869.4 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103006-428

HIV TAT (47-57) GGG-Cys(Npys)

Catalog Number: (103006-428)
Supplier: Anaspec Inc
Description: This peptide corresponds to the protein transduction domain of the TAT protein and is synthesized with an activated cysteine residue C(Npys), wherein Npys is 3-Nitro-2-pyridinesulfenyl group and is used for activating S of cysteine and for rapid reaction when a thiol group is introduced. The N-terminus is rendered free for applications requiring certain conjugation reactions with a free N-terminal end, and a linker GGG is placed at the C-terminal end, and the peptide has been synthesized with the C(Npys) group. This kind of modification has been used to render this peptide as a cell penetrating and carrier peptide applicable in conjugation studies.
Sequence: YGRKKRRQRRRGGG-C(Npys)-NH2
MW: 1987.3 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-TCN0978-200MG

4-Nitrophenyl-N-benzylcarbamate ≥98.0% (by total nitrogen basis)

Catalog Number: (TCN0978-200MG)
Supplier: TCI America
Description: CAS Number: 124068-97-9 MDL Number: MFCD06796634 Molecular Formula: C14H12N2O4 Molecular Weight: 272.26 Purity/Analysis Method: <gt/>98.0% (N) Form: Crystal Melting point (°C): 132

SDS Certificates


Image Unavailable-BT135585-5G

3,4,5-Trichloropyridazine

Supplier: BeanTown Chemical
Description: CAS: 14161-11-6; EC No: 238-006-2 Solid; Molecular Formula: C4HCl3N2; MW: 183.42

SDS

Image Unavailable-TCH1476-1G

Thiazol-2-ylmethanol ≥98.0%

Catalog Number: (TCH1476-1G)
Supplier: TCI America
Description: CAS Number: 14542-12-2 MDL Number: MFCD06200855 Molecular Formula: C4H5NOS Molecular Weight: 115.15 Purity/Analysis Method: <gt/>98.0% (GC) Form: Crystal Boiling point (°C): 76 Melting point (°C): 65

SDS


Image Unavailable-TCL0056-025G

Sodium linoleate ≥95.0% (by titrimetric analysis)

Supplier: TCI America
Description: CAS Number: 822-17-3 MDL Number: MFCD00063202 Molecular Formula: C18H32O2 Molecular Weight: 302.43 Purity/Analysis Method: <gt/>95.0% (T) Form: Crystal Melting point (°C): 192 Storage Temperature: 0-10°C

Certificates

Image Unavailable-103007-522

Gila C2 maleimide)-Exendin-4, HiLyte™ Fluor 647

Catalog Number: (103007-522)
Supplier: Anaspec Inc
Description: This peptide is HiLyte Fluor 647 labeled Exendin-4 (Ex/Em=650 nm/675 nm). A cysteine residue has been added to the peptide C-terminus, and the dye is conjugated to this cysteine via the cysteine thiol moiety. Exendin-4, an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.
Sequence: C(HiLyteFluor 647 C2 maleimide)-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
MW: 5486.3 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-TCT0016-025G

Terephthalonitrile ≥98.0%

Supplier: TCI America
Description: CAS Number: 623-26-7 MDL Number: MFCD00001810 Molecular Formula: C8H4N2 Molecular Weight: 128.13 Purity/Analysis Method: <gt/>98.0% (GC) Form: Crystal Color: White Melting point (°C): 228

Certificates

Image Unavailable-TCA1748-5G

9-Aminoanthracene ≥96.0% (by GC, total nitrogen)

Supplier: TCI America
Description: 9-Aminoanthracene, Purity: >96.0%(GC)(N), CAS Number: 779-03-3, Molecular Formula: C14H11N, Molecular Weight: 193.25, Synonyms: 9-Anthramine, Size: 1G

Image Unavailable-TCM0353-005ML

cis-4-Methylcyclohexanol ≥98.0%

Supplier: TCI America
Description: CAS Number: 7731-28-4 MDL Number: MFCD00064170 Molecular Formula: C7H14O Molecular Weight: 114.19 Purity/Analysis Method: <gt/>98.0% (GC) Form: Clear Liquid Boiling point (°C): 171 Flash Point (°C): 70 Specific Gravity (20/20): 0.93

Certificates

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,929 - 2,944 of 377,217
no targeter for Bottom