You Searched For: Molecular+Bioproducts+Inc.


324,350  results were found

SearchResultCount:"324350"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (103011-416)
Supplier: Anaspec Inc
Description: HiLyte™ Fluor 532 amine is a carbonyl-reactive fluorescent labeling dye.


Catalog Number: (103792-882)
Supplier: ADVANCED BIOMATRIX, INC. MS
Description: Methacrylated Hyaluronic Acid (HA Only)


Supplier: MilliporeSigma
Description: For molecular biology. DNase-, RNase-, protease-, and phosphatase-free.
Supplier: Anaspec Inc
Description: An inhibitor of cell attachment to salmosin and vitronectin.
Sequence:GRGDSP
MW:587.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103007-720)
Supplier: Anaspec Inc
Description: This is a chromogenic substrate for thrombin, Abs=405 nm.
Sequence:f - Pip - R - pNA
MW:552.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C


Catalog Number: (103011-166)
Supplier: Anaspec Inc
Description: Emission-ratiometric fluorescent indicator for quantifying intracellular Ca2+ concentration.


Catalog Number: (103007-566)
Supplier: Anaspec Inc
Description: This Abeta peptide (11-40) is FAM-labeled (Abs/Em=494/521 nm). FAM is preferred over FITC because of its photo- and chemical stability.
Sequence: 5-FAM-EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 3510 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (103007-136)
Supplier: Anaspec Inc
Description: This peptide is the beta-Amyloid peptide, residues 1 to 16 labeled with HiLyte™ Fluor 488 on the Lys16, Abs/Em =501/527.
Sequence: DAEFRHDSGYEVHHQ-K(HiLyte™ Fluor 488)
Molecular Weight: 2311.4 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (103007-698)
Supplier: Anaspec Inc
Description: ClearPoint™ beta-Amyloid (1-40) is a heavy-isotope labeled peptide. All the Arginine and Lysines have universally labeled 13C and 15N.
Sequence: DAEF-R*-HDSGYEVHHQ-K*-LVFFAEDVGSN-K*-GAIIGLMVGGVV [R*=R(U-13C6, U-15N4) & K*=K(U-13C6, U-15N2)]
Molecular Weight: 4355.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (103008-452)
Supplier: Anaspec Inc
Description: This peptide is amino acids 3 to 16 fragment of beta-Amyloid (Aß) with an N-terminal deletion that alters the coordination environment for the Cu2+ binding site. Oxidation targets for Aß (1-16) are the histidine residues coordinated to the meta.
Sequence: EFRHDSGYEVHHQK
Molecular Weight: 1768.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (103006-672)
Supplier: Anaspec Inc
Description: This is a scrambled sequence of LL-37 used in control experiments.
Sequence: GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
MW: 4493.3 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C


Catalog Number: (103007-790)
Supplier: Anaspec Inc
Description: This peptide is a substrate for p70 ribosomal S6 kinase.
Sequence:KKRNRTLTV
MW:1115.4 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (BJ94318-250ML)
Supplier: Honeywell Research Chemicals
Description: Formic acid, Analytical, Spectroscopy Reagent, Purity: Approximately 98% (T), Grade: Analytical, CAS number: 64-18-6, Molecular formula: HCOOH, Molar Mass: 46.03 g/mol, Container Type: Poly bottle, Appearance: Colorless, Liquid, Applica

Catalog Number: (103011-056)
Supplier: Anaspec Inc
Description: DABCYL Plus™ C2 maleimide is an excellent thiol-reactive building block for developing DABCYL Plus™-based FRET probes.


Catalog Number: (103010-932)
Supplier: Anaspec Inc
Description: Spectra of HiLyte™ Fluor 555 conjugates are slightly red-shifted compared to those of Cy3 dyes, resulting in an optimal match to filters designed for Cy3 dyes.


Catalog Number: (103011-028)
Supplier: Anaspec Inc
Description: 5(6)-TAMRA cadaverine is a useful reagent for modifying carboxy groups via EDC-mediated reactions. It is a good glutamate transglutaminase substrate and a useful building block for small fluorescent molecules.


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
273 - 288 of 324,350
no targeter for Bottom