Print…

You Searched For: solder


613,138  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"613138"

Rate These Search Results

Image Unavailable-103012-382

Human Semaphorin 4D/SEMA4D/CD100 Protein 1mg

Description: Human Semaphorin 4D/SEMA4D/CD100 Protein, Host: HEK293 cells, species reactivity: human, Purity: >95% SDS-PAGE, Molecular Characterization: Fc Tag is fused with a human IgG1 Fc tag at the C-terminus, MW of 105.4 kDa, Synonym: SEMA4D, CD100, Size: 1mg
Catalog Number: 103012-382
Supplier: ACROBIOSYSTEMS
Product Image-76446-870

VWR* Tube Pcr 8-Strip with Hinged Flat Caps assorted colors, Strips of hinged attached caps prevent accidents common with separate caps, Uniform thin walls, For use in medical, pharmaceutical and food industry, and molecular biology, Certified free of detectable RNase, DNase

Description: VWR* Tube Pcr 8-Strip with Hinged Flat Caps assorted colors, Strips of hinged attached caps prevent accidents common with separate caps, Uniform thin walls, For use in medical, pharmaceutical and food industry, and molecular biology, Certified free of detectable RNase, DNase
Catalog Number: 76446-870
Supplier: VWR International
Image Unavailable-103790-782

Recom HEK293 Reg4 hu >95% 16.7 kDa 1mg

Description: Reg4 Protein Reg4, His Tag, Recombinant, Source: HEK293, Species: human,Purity: >95% as determined by SDS-PAGE, Molecular weight: 16.7 kDa, Endotoxin: Less than 1.0 EU per ug by the LAL method, Synonyms: REG4, GISP, REG-IV, RELP, Size: 1mg
Catalog Number: 103790-782
Supplier: ACROBIOSYSTEMS
Image Unavailable-103790-814

Recom Siglec-15 CD33L3 mouse >90% 1mg

Description: Siglec-15 CD33L3 Protein, His Tag, Recombinant, Source: HEK293, Species: mouse,Purity: >90% as determined by SDS-PAGE, Molecular weight: 27.5 kDa, Synonyms: CD33L3, sialic acid-binding Ig-like lectin 15, Siglec15, Siglec-15, Size: 1mg
Catalog Number: 103790-814
Supplier: ACROBIOSYSTEMS
Image Unavailable-103790-812

Recom Siglec-15 CD33L3 mouse >90% 100UG

Description: Siglec-15 CD33L3 Protein, His Tag, Recombinant, Source: HEK293, Species: mouse,Purity: >90% as determined by SDS-PAGE, Molecular weight: 27.5 kDa, Synonyms: CD33L3, sialic acid-binding Ig-like lectin 15, Siglec15, Siglec-15, Size: 100UG
Catalog Number: 103790-812
Supplier: ACROBIOSYSTEMS
Image Unavailable-103011-370

TMRM 25 mg

Description: TMRM, Synonym: Tetramethylrhodamine, methyl ester, perchlorate, Used for measuring membrane potential of mitochondria; Fluorescence is less dependent on dye location, Molecular Weight: 500.9, Spectral Properties: Abs/Em = 549/573 nm, Solvent System DMSO, Storage: -20 deg C, Size: 25mg
Catalog Number: 103011-370
Supplier: Anaspec Inc
Image Unavailable-103790-418

Recom Gitr Ligand > 90% Hu 20.5 Kda 1Mg

Description: GITR Ligand Recombinant, Purity: > 90%, Species Reactivity: Human, Source: HEK293, Molecular Weight: 20.5 kDa, Tag: His Tag, Endotoxin: Less than 1.0 EU per ug by the LAL method, Synonyms: TNFSF18, AITRL, TL6, hGITRL, GITR Ligand, Size: 1mg
Catalog Number: 103790-418
Supplier: ACROBIOSYSTEMS
Image Unavailable-103790-798

Recom Siglec15CD33L3 Cynomolgus >90% 1mg

Description: Siglec-15 CD33L3 Protein, His Tag, Recombinant, Source: HEK293, Species: Cynomolgus,Purity: >90% as determined by SDS-PAGE, Molecular weight: 28.1 kDa, Synonyms: CD33L3, sialic acid-binding Ig-like lectin 15, Siglec15, Siglec-15, Size: 1mg
Catalog Number: 103790-798
Supplier: ACROBIOSYSTEMS
Image Unavailable-103790-098

Recom B7-H2 > 95% Mouse 52.7 Kda 1Mg

Description: B7-H2 Recombinant, Purity: > 95%, Species Reactivity: Mouse, Source: HEK293, Molecular Weight: 52.7 kDa, Tag: Fc Tag, Endotoxin: Less than 1.0 EU per ug by the LAL method, Synonyms: ICOSLG, B7-H2, B7H2, B7RP-1, Size: 1mg
Catalog Number: 103790-098
Supplier: ACROBIOSYSTEMS
Image Unavailable-103790-594

Recom IL-23 R human >95% 64.5 kDa 1mg

Description: IL-23 R Protein, Fc Tag, Recombinant, Source: HEK293, Species: human,Purity: >95% as determined by SDS-PAGE, Molecular weight: 64.5 kDa, Endotoxin: Less than 1.0 EU per ug by the LAL method, Synonyms: IL-23 R, IL-23 Receptor, Size: 1mg
Catalog Number: 103790-594
Supplier: ACROBIOSYSTEMS
Image Unavailable-103790-592

Recom IL-23 R human >95% 64.5 kDa 100UG

Description: IL-23 R Protein, Fc Tag, Recombinant, Source: HEK293, Species: human,Purity: >95% as determined by SDS-PAGE, Molecular weight: 64.5 kDa, Endotoxin: Less than 1.0 EU per ug by the LAL method, Synonyms: IL-23 R, IL-23 Receptor, Size: 100UG
Catalog Number: 103790-592
Supplier: ACROBIOSYSTEMS
Image Unavailable-103014-090

Human CD36/SR-B3 Protein

Description: CD36/SR-B3 Protein, Host: HEK293 cells, Species Reactivity: Human, Purity: >95% (SDS-PAGE), Molecular Characterization: His Tag fused with polyhistidine tag at C-terminus, MW 47.5KDa, Synonyms: CD36,SCARB3,BDPLT10,CHDS7,FAT,GP3B,GP4, Storage: 4 deg C, Size: 100ug
Catalog Number: 103014-090
Supplier: ACROBIOSYSTEMS
Image Unavailable-103790-836

Recom Tau-441 2N4R human >90% sds 100UG

Description: Tau-441 2N4R Protein, His Tag, Recombinant, Source: E.coli cells, Species: human,Purity: >90% as determined by reduced SDS-PAGE, Molecular weight: 47.9 kDa, Synonyms: DDPAC, FTDP-17, MAPT, MSTD, MTBT1, Tau, PHF-tau, TAU, Size: 100UG
Catalog Number: 103790-836
Supplier: ACROBIOSYSTEMS
Image Unavailable-103790-838

Recom Tau-441 2N4R hu >90% 47.9 kDa 1mg

Description: Tau-441 2N4R Protein, His Tag, Recombinant, Source: E.coli cells, Species: human,Purity: >90% as determined by reduced SDS-PAGE, Molecular weight: 47.9 kDa, Synonyms: DDPAC, FTDP-17, MAPT, MSTD, MTBT1, Tau, PHF-tau, TAU, Size: 1mg
Catalog Number: 103790-838
Supplier: ACROBIOSYSTEMS
Product Image-76446-862

VWR* Tube, Pcr 8-Strip, 0.2Ml, assorted colors, Ultra-thin walls ensure efficient thermal transfer and maximum yield, yet are strong enough to prevent crushing, For use in medical, pharmaceutical and food industry, and molecular biology, Clear tubes provide high clarity for visualizing contents

Description: VWR* Tube, Pcr 8-Strip, 0.2Ml, assorted colors, Ultra-thin walls ensure efficient thermal transfer and maximum yield, yet are strong enough to prevent crushing, For use in medical, pharmaceutical and food industry, and molecular biology, Clear tubes provide high clarity for visualizing contents
Catalog Number: 76446-862
Supplier: VWR International
Image Unavailable-103003-156

Adrenomedullin (22-52) 0.5 mg

Description: Adrenomedullin (22-52), human, Purity: HPLC >/- 95%, Molecular Weight: 3576, Sequence: TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2, AM (22-52) is known as an adrenomedullin receptor antagonist and a cardiac depressant factor, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 103003-156
Supplier: Anaspec Inc
641 - 656 of 613,138