Print…

You Searched For: Molecular+Bioproducts+Inc.


377,159  results were found

Refine Results Sort by
SearchResultCount:"377159"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-10772-386

Human Recombinant KLF4-TAT (from HEK293 Cells)

Supplier: PeproTech, Inc.
Description: KLF4 is a member of the Kruppel-like factor (KLF) family of zinc finger transcription factors. Members of this family share 3 contiguous C2H2-type zinc fingers at the carboxyl terminus that comprise the DNA-binding domain. KLF4 is highly expressed in skin and gut epithelial tissues, but is also found in various other cells and tissues, including vascular endothelial cells, lymphocytes, lung, and testis. It is an important regulator of the cell cycle, transcription, and cell differentiation. Together with Sox2, Oct4, and cMyc, KLF4 can induce the reprogramming of primary human fibroblasts to a pluripotent state. KLF4 and other transcription factors can be introduced into cells by DNA transfection, viral infection, or microinjection. Protein transduction using TAT fusion proteins represents an alternative methodology for introducing transcription factors into primary, as well as transformed, cells. Recombinant Human KLF4-TAT is a 483 amino acid protein, including a 13-residue C-terminal TAT peptide, with a calculated molecular weight of 51.7 kDa. PeproTech’s Recombinant Human KLF4-TAT is a mixture of the expected sequence beginning at Met1 and a truncated isoform beginning at Tyr54. Due to post-translational modifications, SDS-PAGE gel shows bands at approximately 72 and 66kDa, under reduced conditions.

Image Unavailable-TCB4309-1G

3,3'-Bipiperidine ≥98.0% (by GC, titration analysis)

Catalog Number: (TCB4309-1G)
Supplier: TCI America
Description: CAS Number: 46040-83-9 Molecular Formula: C10H20N2 Molecular Weight: 168.28 Purity/Analysis Method: <gt/>98.0% (GC,T) Form: Crystal Melting point (°C): 105

SDS


Image Unavailable-TS442991000

n-Pentane, extra dry over Molecular Sieve 99+%, AcroSeal®

Supplier: THERMO FISHER SCIENTIFIC CHEMICALS
Description: n-Pentane, extra dry over Molecular Sieve 99+%, AcroSeal®

New Product

Image Unavailable-103886-012

40596-V07E

Catalog Number: (103886-012)
Supplier: Sino Biological
Description: Helicase-His Recombinant Protein, Purity: > 80 % as determined by SDS-PAGE, Expressed Host: E. Coli, Species: SARS-CoV-2, Molecular Mass: consists of 608 amino acids and predicts a molecular mass of 67.8 kDa, Size: 100 ug
Image Unavailable-BT127055-1G

Polystyrene Standard, M.W ≈1,300, MW/MN = 1.06

Catalog Number: (BT127055-1G)
Supplier: BeanTown Chemical
Description: Polystyrene standard, approximate molecular weight: 1, 300, Weight-average molecular weight per Number-average molecular weight is 1.06, Synonyms: PS, Size: 1G

SDS


Image Unavailable-TCD4555-1G

Dimethylamine hydroiodide ≥98.0% (by total nitrogen and titration analysis)

Supplier: TCI America
Description: CAS Number: 51066-74-1 Molecular Formula: C2H7N Molecular Weight: 173.00 Purity/Analysis Method: <gt/>98.0% (N,T) Form: Crystal Melting point (°C): 155

SDS

Image Unavailable-TCB5079-5G

3-Bromo-4-ethoxybenzaldehyde ≥97.0% (by GC)

Supplier: TCI America
Description: 3-Bromo-4-ethoxybenzaldehyde, Purity: >97.0%(GC), CAS Number: 108373-05-3, Molecular Formula: C9H9BrO2, Molecular Weight: 229.07, Size: 1G

Image Unavailable-TCB5036-5G

5-Bromo-2-methylbenzaldehyde ≥95.0% (by GC)

Supplier: TCI America
Description: 5-Bromo-2-methylbenzaldehyde, Purity: >95.0%(GC), CAS Number: 90050-59-2, Molecular Formula: C8H7BrO, Molecular Weight: 199.05, Size: 1G

Product Image-TS32739-0010

Water for molecular biology

Supplier: THERMO FISHER SCIENTIFIC CHEMICALS
Description: Water for molecular biology

Image Unavailable-TCB5073-1G

3-Bromo-4-methylbenzaldehyde ≥96.0% (by GC)

Supplier: TCI America
Description: 3-Bromo-4-methylbenzaldehyde, Purity: >96.0%(GC), CAS Number: 36276-24-1, Molecular Formula: C8H7BrO, Molecular Weight: 199.05, Size: 5G

Certificates

Product Image-JT4014-2

β-(N-Morpholino)ethanesufonic acid (MES) monohydrate free acid ≥98%, crystalline, Ultrapure Bioreagent for liquid chromatography, for molecular biology, J.T.Baker®

Supplier: AVANTOR PERFORMANCE MATERIAL LLC
Description: Buffer for liquid chromatography and other molecular biology applications. Lot analysis on label.

SDS Certificates

Image Unavailable-TCM0791-5ML

6-Methyl-2-heptanol ≥97.0% (by GC)

Catalog Number: (TCM0791-5ML)
Supplier: TCI America
Description: 6-Methyl-2-heptanol, Purity: >97.0%(GC), CAS Number: 4730-22-7, Molecular Formula: C8H18O, Molecular Weight: 130.23, Size: 5ML
Image Unavailable-TCC0497-025G

4-Cyclohexylcyclohexanol ≥98.0%

Supplier: TCI America
Description: CAS Number: 2433-14-9
MDL Number: MFCD00060071
Molecular Formula: C12H22O
Molecular Weight: 182.31
Purity/Analysis Method: >98.0% (GC)
Form: Crystal

Certificates

Image Unavailable-103010-102

Rat GIP

Supplier: Anaspec Inc
Description: GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide) is a 42-amino acid peptide released by the K cells of the duodenum and jejunum in response to food intake. GIP, together with GLP (Gastric-like Peptide) are members of the hormone peptide family of Incretins which stimulate insulin secretion from pancreatic islet β-cells, and also appears to promote beta cell proliferation and beta cell survival. Recent studies suggest that GIP plays a role in lipid homeostasis and possibly in the pathogenesis of obesity.
Sequence: YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ
MW: 5002.95 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Image Unavailable-TCB0512-025G

Biurea

Supplier: TCI America
Description: CAS Number: 110-21-4 MDL Number: MFCD00025398 Molecular Formula: C2H6N4O2 Molecular Weight: 118.10 Form: Crystal Color: White

Certificates

Image Unavailable-TCC3081-5G

3-Chloro-2-ethoxypyridine ≥98.0% (by GC, titration analysis)

Supplier: TCI America
Description: 3-Chloro-2-ethoxypyridine, Purity: >98.0%(GC)(T), CAS Number: 177743-06-5, Molecular Formula: C7H8ClNO, Molecular Weight: 157.60, Size: 1G

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,753 - 2,768 of 377,159
no targeter for Bottom