You Searched For: Molecular+Bioproducts+Inc.

Supplier: Thermo Scientific Chemicals

Description: DNA ladders are used in gel electrophoresis to determine the size and quantity of testing DNA fragments of genomic, plasmid, and PCR DNA.

SDS Certificates

Supplier: Ward's Science

Description: CAS Number: 7446-19-7
Formula Weight: 179.45
Formula: ZnSO₄·H₂O
Hazard Info: Irritant
Density (g/mL): 3.35
Solubility: Water
Shelf Life (months): 12
Storage: Green

SDS

Catalog Number: (RLMB-104-0500)

Supplier: Rockland Immunochemical

Description: Lambda phage consists of a virus particle including a head (also known as a capsid), a tail, and tail fibers

SDS Sale

Catalog Number: (470135-976)

Supplier: Wards

Description: The model shows the delicate structure of an animal cell.

Sale

Catalog Number: (470136-018)

Supplier: Wards

Description: This set is an easy-to-construct, three-dimensional model of DNA.

Sale

Catalog Number: (PAG4511)

Supplier: Promega Corporation

Description: Twelve DNA fragments ranging from 25bp to 300bp in 25bp increments includes a visible 1,800bp "backbone" fragment.

Certificates Sale

Catalog Number: (103008-696)

Supplier: Anaspec Inc

Description: GLP-1 (9-36) is the result of the rapid degradation of GLP-1 (7-36)amide, by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. GLP-1 (9-36) accounts for the majority of GLP-1 that reaches the system circulation. Whereas GLP-1 (7-36) amide stimulates glucose-dependent insulin secretion and inhibits glucagon secretion, GLP-1(9-36)amide administration had no effect on glucose clearance or insulin secretion in humans. GLP-1(9-36)amide however was shown to exert cardioprotective actions in rodent hearts.
Sequence: EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 3089.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Sale

Catalog Number: (102999-778)

Supplier: Anaspec Inc

Description: This is Oxytocin (OT) N-terminally labeled with Biotin. OT is a 9-amino acid peptide that is synthesized primarily in the hypothalamic neurons, specifically the magnocellular oxytocin neurons in the supraoptic and paraventricular nuclei and is secreted by the posterior pituitary gland. It is also secreted from other tissues, such as the ovaries and testes. Circulating OT is important during parturition and lactation. In the pregnant uterus, oxytocin and the oxytocin receptor play a major part for uterine contractility and the induction of labor. OT is also involved in complex social behaviors such as affiliation, sexual behavior, social recognition, stress buffering, aggression, and trust.
Sequence: Biotin-CYIQNCPLG-NH2 (Disulfide bridge: 1-6)
MW: 1234.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Sale

Catalog Number: (103008-632)

Supplier: Anaspec Inc

Description: This peptide is histone H4 amino acid residues 1 to 21. It is asymmetrically dimethylated at Arg3 with both methyl groups added to one nitrogen of the guanidinium group, and also contains a C-terminal GG linker, followed by a biotinylated Lys. Methylation of histone H4 at Arg3 is an important step in transcriptional activation, and allows for subsequent acetylation of H4 tails by p300. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:Ac-SG-R(Me2a)-GKGGKGLGKGGAKRHRKV-GGK(Biotin)
MW:2630.14 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (470225-800)

Supplier: Ward's Science

Description: CAS Number: 7681-49-4
Formula Weight: 41.99
Formula: NaF
Hazard Info: Toxic
Density (g/mL): 2.78
Boiling Point (°C): 1704
Freezing Point (°C): 993
Solubility: Water and Alcohol
Synonyms: Fluoridine
Shelf Life (months): 36
Storage: Blue

SDS Sale

Catalog Number: (470225-814)

Supplier: Ward's Science

Description: CAS Number: 10042-76-9
Formula Weight: 211.63
Formula: Sr(NO₃)₂
Hazard Info: Oxidizer, Flammable, Toxic, Irritant
Density (g/mL): 2.986
Freezing Point (°C): 570
Solubility: Water and Alcohol
Shelf Life (months): 36
Storage: Yellow

SDS Sale

Supplier: Anaspec Inc

Description: Although FITC reagents have been more often used to prepare fluoresceinated bioconjugates, the low stability of FITC bioconjugates makes some researchers use amine-reactive succinimidyl esters of carboxyfluorescein (commonly called FAM) in bioconjugations. FAM reagents give carboxamides that are more resistant to hydrolysis. We have shown that FAM reagents require less stringent reaction conditions and give better conjugation yields, and the resulted conjugates have superior stability. We noted that FITC labeled peptides tend to deteriorate more quickly than the corresponding FAM conjugates.

Supplier: PeproTech, Inc.

Description: CD30 ligand (CD30L) is a type-II membrane-associated glycoprotein belonging to the TNF superfamily and is expressed primarily on certain B cells, T cells, and monocytes. CD30L binds specifically to CD30 (receptor), which is expressed on activated, but not resting, B and T cells, in lymphomas and various chronically inflamed tissues. CD30L/CD30 interactions initiate a signaling cascade that can ultimately lead to the activation of NF-κB. CD30L/CD30 signaling exerts pleiotropic effects on normal cells, including cell death, differentiation, and cell division. Certain diseases, including Hodgkin’s lymphoma, allergic inflammation, diabetes (in NOD mice), and mycobacterial infection can also be affected by CD30L/CD30 signaling. The CD30L gene encodes for a 234 amino acid type II transmembrane protein, which contains a 37 amino acid cytoplasmic sequence, a 25 amino acid transmembrane domain and a 172 amino acid extracellular domain. Recombinant Human soluble CD30L (sCD30L) is a 188 amino acid polypeptide corresponding to the extracellular domain, and contains an 8 residue N-terminal His-Tag. The calculated molecular weight of Recombinant Human sCD30 Ligand is 21.3 kDa.

Catalog Number: (10799-442)

Supplier: VWR

SDS Certificates Sale

Catalog Number: (101228-410)

Supplier: New England Biolabs (NEB)

Description: The ssRNA Ladder is a set of 7 RNA molecules produced by in vitro transcription of a mixture of 7 linear DNA templates

Sale

Catalog Number: (101418-106)

Supplier: New England Biolabs (NEB)

Description: The microRNA Marker is a set of three synthetic single-stranded RNA oligonucleotides 17, 21 and 25 residues long that have free 5´ ends (i.e., no 5´ phosphate groups)

Sale