Print…

You Searched For: Molecular+Bioproducts+Inc.


567,737  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"567737"

Rate These Search Results

Image Unavailable-103015-080

CD200/OX-2 Protein 1mg

Description: CD200/OX-2 Protein, Host: HEK293, Species Reactivity: Human, Purity: >98% by SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at the C-terminus, calculated MW of 23.4 kDa, Synonym: CD200,MOX1,MOX2,MRC,OX-2,My033, Storage: 4 degree Celcius, Size: 1mg
Catalog Number: 103015-080
Supplier: ACROBIOSYSTEMS
Image Unavailable-103013-776

Mouse TIM-3/HAVCR2 Protein

Description: TIM-3/HAVCR2 Protein, Host: HEK293 cells, Species Reactivity: Mouse, Purity: >95% (SDS-PAGE), Molecular Characterization: His Tag fused with polyhistidine tag at C-terminus, MW of 21 KDa, Synonyms: HAVCR2,TIM3,TIMD3,FLJ14428,KIM3, Storage: 4 deg C, Size: 100ug
Catalog Number: 103013-776
Supplier: ACROBIOSYSTEMS
Image Unavailable-103012-370

Human CD30/TNFRSF8 Protein 1mg

Description: Human CD30/TNFRSF8 Protein, Host: HEK293 cells, species reactivity: human, Purity: >95% SDS-PAGE, Molecular Characterization: Fc Tag is fused with a human IgG1 Fc tag at the C-terminus, MW of 39.3 kDa, Synonym: TNFRSF8,CD30, Storage: 4 deg C, Size: 1 mg
Catalog Number: 103012-370
Supplier: ACROBIOSYSTEMS
Image Unavailable-103013-910

Human VCAM-1/CD106 Protein

Description: VCAM-1/CD106 Protein, Host: HEK293 cells, Species Reactivity: Human, Purity: >92% (SDS-PAGE), Molecular Characterization: His Tag is fused with a polyhistidine tag at C-terminus, MW of 75 KDa, Synonyms: VCAM1,CD106,L1CAM,INCAM-100, Storage: 4 deg C, Size: 100ug
Catalog Number: 103013-910
Supplier: ACROBIOSYSTEMS
Image Unavailable-103014-772

Mouse IL-4 R alpha/CD124 Protein

Description: IL-4 R alpha / CD124 Protein, Host: HEK293 Cells, Species Reactivity: Mouse, purity: >95%, Molecular Characterization: polyhistidine tag at the C-terminus, MW of 26.3 kDa, Less than 1.0 EU per ug , Synonym: IL4R,CD124,IL4RA, Storage: 4 deg C, Size: 1MG
Catalog Number: 103014-772
Supplier: ACROBIOSYSTEMS
Image Unavailable-103012-946

Human FABP1/L-FABP Protein 200ug

Description: FABP1/L-FABP Protein, Host: E.coli, Species reactivity: Human, Purity: >95% SDS-PAGE, Molecular Characterization: fused with 6xHis tag at N-terminus, MW 15 kDa, Endotoxin: <1.0 EU per ug, Synonym: FABP1, FABPL, L-FABP, Storage: at 4 deg C, Size: 200ug
Catalog Number: 103012-946
Supplier: ACROBIOSYSTEMS
Image Unavailable-103012-400

Human CD31/PECAM-1 Protein 100ug

Description: Human CD31/PECAM-1 Protein, Host: HEK293 cells, species reactivity: human, Purity: >98% SDS-PAGE, Molecular Characterization: Fc Tag is fused with a human IgG1 Fc tag at the C-terminus, MW of 65.3 kDa, Synonym: PECAM1,CD31,FLJ34100,FLJ58394, Size: 100ug
Catalog Number: 103012-400
Supplier: ACROBIOSYSTEMS
Image Unavailable-103013-774

Mouse TIM-3/HAVCR2 Protein 1mg

Description: TIM-3/HAVCR2 Protein, Host: HEK293 cells, Species Reactivity: Mouse, Purity: >95% (SDS-PAGE), Molecular Characterization: His Tag fused with polyhistidine tag at C-terminus, MW of 21 KDa, Synonyms: HAVCR2,TIM3,TIMD3,FLJ14428,KIM3, Storage: 4 deg C, Size: 1mg
Catalog Number: 103013-774
Supplier: ACROBIOSYSTEMS
Image Unavailable-103015-076

CD200/OX-2 Protein 1mg

Description: CD200/OX-2 Protein, Host: HEK293, Species Reactivity: Human, Purity: >98% by SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at the C-terminus, calculated MW of 23.4 kDa, Synonym: CD200,MOX1,MOX2,MRC,OX-2,My033, Storage: 4 degree Celcius, Size: 1mg
Catalog Number: 103015-076
Supplier: ACROBIOSYSTEMS
Image Unavailable-103012-854

Human EGF R Protein 1mg

Description: EGF R Protein, Host: HEK293 Cells, Species reactivity: Human, Purity: >95% by SDS-PAGE, Molecular Characterization: His Tag is fused with a polyhistidine tag at the C-terminus, MW of 69.5 kDa, Synonym: EGFR, ERBB, ERBB1, HER1, PIG61, mENA, Storage: at 4 deg C, Size: 1mg
Catalog Number: 103012-854
Supplier: ACROBIOSYSTEMS
Image Unavailable-103015-546

ActiveMax* Recombinant TNF-alpha 100ug

Description: ActiveMax* Recombinant TNF-alpha (HPLC-verified), Host: HEK293, Species Reactivity: Human, Purity: >95% by SEC-HPLC/ SDS-PAGE, Molecular Characterization: contains no tag, MW of 17.4 kDa, Synonym: DIF,TNF-alpha,TNFA,TNFSF2, Storage: 4 deg C, Size: 100ug
Catalog Number: 103015-546
Supplier: ACROBIOSYSTEMS
Image Unavailable-103012-294

Human CADM1/IGSF4A Protein 1mg

Description: Human CADM1/IGSF4A Protein, Host: HEK293 cells, Species Reactivity: Human, purity: >95% SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at the C-terminus, MW of 38.5 kDa, Synonym: CADM1,BL2,IGSF4,IGSF-4,IGSF4A, Storage: 4 Degree C, size: 1mg
Catalog Number: 103012-294
Supplier: ACROBIOSYSTEMS
Image Unavailable-103014-442

Human HSA Protein 500UG

Description: HSA Protein, Host: HEK293 Cells, Species Reactivity: Human, purity: >95%, Molecular Characterization: fused with a polyhistidine tag at the C-terminus, MW of 67.3 kDa, Endotoxin: Less than 1.0 EU per ug, Synonym: HSA,ALB,Serum Albumin, Storage: 4 deg C, Size: 500UG
Catalog Number: 103014-442
Supplier: ACROBIOSYSTEMS
Image Unavailable-103003-366

HBD-3 B-Defensin-3 human 0.1 mg

Description: HBD-3, B-Defensin-3, human, Purity: HPLC >/- 95%, Molecular Weight: 5155.2, Sequence: GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK, this is a 5.1kDa 45-amino acid antimicrobial peptide called beta-Defensin-3 having a beta sheet, Size: 0.1 mg
Catalog Number: 103003-366
Supplier: Anaspec Inc
Image Unavailable-103011-220

EGTA 10 mL

Description: EGTA, tetrasodium salt, 10 mM aqueous solution UltraPure Grade, Purity: One spot by TLC, Molecular Weight: 468.3, Solvent System: Water (High), MF: C14H20Na4N2O10, CAS number: 13368-13-3, Physical State: 10mM aqueous solution, Storage: 4 deg C Store away from oxidizing agent, Size: 10ml
Catalog Number: 103011-220
Supplier: Anaspec Inc
Image Unavailable-103004-120

Biotin - LC - MBP Derivatized Peptide 5 mg

Description: Biotin - LC - MBP Derivatized Peptide, Purity: Peak Area By HPLC >/= 95%, Molecular Weight 2252.7, Sequence (One-Letter Code): Biotin-LC-FFKNIVTPRTPPPSQGK-NH2, Physical State: Solid, Storage: -20 deg C Store away from oxidizing agent, Size: 5 mg
Catalog Number: 103004-120
Supplier: Anaspec Inc
2,593 - 2,608 of 567,737