Print…

You Searched For: PERKINELMER U.S. LLC


377,029  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"377029"

Rate These Search Results

Image Unavailable-103007-474

Secretoneurin

Description: This peptide is amino acids 154 to 186 fragment of secretogranin II, designated secretoneurin. Secretoneurin is a neuropeptide generated in brain, adrenal medulla and other endocrine tissues by proteolytic processing of secretogranin II. Secretoneurin acts as direct angiogenic cytokine, inhibits endothelial cell (EC) apoptosis, stimulates EC proliferation, and activates the mitogen-activated protein kinase (MAPK) system and the Akt pathway.
Sequence:TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ
MW:3652 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103007-474
Supplier: Anaspec Inc
Image Unavailable-103007-258

HIV TAT-NSF700 Fusion Peptide

Description: This peptide is the N-Ethyl-maleimide-sensitive factor (NSF) inhibitor fusion polypeptide composed of 11-amino acid cell permeable HIV transactivating regulatory protein (TAT) domain fused to a 22 amino acid NSF domain. TAT-NSF700 inhibits thrombin-induced exocytosis of endothelial cells in a dose-responsive manner.
Sequence: YGRKKRRQRRR-GGG-LLDYVPIGPRFSNLVLQALLVL
MW: 4167 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Catalog Number: 103007-258
Supplier: Anaspec Inc
Image Unavailable-102999-762

Human ACTH (1-39),Biotin

Description: This C-terminally labeled biotin ACTH (1-39) has been used in ELISA assays. This 39 amino acid-peptide hormone is produced in the anterior pituitary gland upon stimulation by the corticotropin releasing hormone from the hypothalamus in response to stress. It stimulates the secretion of steroid hormone, specifically glucocorticoids in the adrenal cortex by acting through a cell membrane receptor (ACTH-R).
Sequence: Biotin - SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
MW: 4768.4 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Catalog Number: 102999-762
Supplier: Anaspec Inc
Image Unavailable-103007-500

Human PLP

Description: This is amino acids 178 to 191 fragment of the proteolipid protein (PLP), an immunodominant encephalitogenic epitope in SJL mice, one of two major encephalitogenic epitopes. PLP peptide 178 to 191 was compared with another encephalitogenic peptide, 139 to 151. The day of onset of disease induced by PLP 178 to 191 was earlier, but the incidence, severity, and histologic features were indistinguishable.
Sequence: NTWTTCQSIAFPSK
MW: 1583.8 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Catalog Number: 103007-500
Supplier: Anaspec Inc
Image Unavailable-103007-114

Human [Gly22]-beta-Amyloid (1-42)

Description: This is amino acids 1 to 40 fragment of the mutant form of beta-amyloid, with glycine substituted for glutamic acid at position 22 found in “Arctic” heredity. A toxic soluble beta-amyloid assembly (TA-beta) is formed more rapidly from 'Arctic' beta-amyloid than from wild-type beta-amyloid in the presence of liposomes containing GM1 ganglioside.
Sequence: DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA
MW: 4442.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Catalog Number: 103007-114
Supplier: Anaspec Inc
Image Unavailable-103006-560

Rat rCRAMP

Description: This peptide is a rat homologue of the human cathelicidin LL-37. Rat cathelicidin-related antimicrobial peptide (rCRAMP) was identified in granulocytes, thymus, testis, lung, mouth mucosa, tongue, oesophagus, colon, caecum and small intestine. The rCRAMP peptide is present in specific CNS regions and may play a role in the innate immunity of the CNS. rCRAMP exhibits pro-healing activity in stomach.
Sequence:GLVRKGGEKFGEKLRKIGQKIKEFFQKLALEIEQ
MW:3946.7 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103006-560
Supplier: Anaspec Inc
Product Image-470225-702

Iron(III) Nitrate Nonahydrate

Description: CAS Number: 7782-61-8
Formula: FeNO33 9H2O
Density: 1.68 g/mL
Freezing Point: 47.2°C
Solubility: Water and Alcohol
Synonyms: Iron (III) Nitrate 9-Hydrate, Ferric Nitrate Nonahydrate
Shelf Life: 12 Months
Catalog Number: 470225-702
Supplier: Ward's Science

SDS


Image Unavailable-103003-028

Prosaptide TX14(A) Peptide

Description: This 14-mer prosaptide sequence is derived from the active neurotrophic region in the amino-terminal portion of the saposin C domain. Synthetic peptides derived from this region are biologically active and are named “prosaptides.” Prosaposin and prosaptides are active on a variety of neuronal cells, stimulating sulfatide synthesis and increasing sulfatide concentration in Schwann cells and oligodendrocytes. This indicates that prosaposin and prosaptides are trophic factors for myelin formation.
Sequence:TaLIDNNATEEILY
MW:1579.7 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103003-028
Supplier: Anaspec Inc
Image Unavailable-10014-580

AMPIGENE® DNA Ladder 100 to 10000 bp, Enzo Life Sciences

Description: Ready to use DNA standards for quantifying PCR yield
Catalog Number: 10014-580
Supplier: Enzo Life Sciences

SDS


Product Image-470225-712

Potassium Sulfate

Description: CAS Number: 7778-80-5
Formula Weight: 174.27
Formula: K2SO4
Density (g/mL): 2.662
Boiling Point (°C): 1067
Freezing Point (°C): 1689
Solubility: Water
Synonyms: Sal Polychrestum
Shelf Life (months): 36
Storage: Green
Catalog Number: 470225-712
Supplier: Ward's Science

SDS


Image Unavailable-103006-404

Substance P, FAM (Carboxyfluorescein)

Description: Substance P (SP) is an important neuropeptide belonging to the tachykinin family. It acts as a neurotransmitter and neuromodulator. It is closely related to neurokinin A, both originating from the same precursor preprotachykinin A. It is released from the terminals of sensory nerves and is involved in inflammation and pain processes. This peptide is a fluorescent (FAM)-labeled Substance P, Abs/Em = 494/521 nm.
Sequence:FAM-RPKPQQFFGLM-NH2
MW:1706 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103006-404
Supplier: Anaspec Inc
Image Unavailable-103003-266

Casein Kinase 2 (CK2) Substrate alpha

Description: Type II casein kinase (CK-2) is unique among the protein kinases since it can use ATP as well as GTP as a phosphoryl donor. It is extremely sensitive to heparin inhibition and can be activated by polyamines and basic polypeptides. This peptide contains the consensus phosphorylation sequence for CK2 and can be used as the substrate for CK2 a-subunit.
Sequence:RRRDDDSDDD
MW:1264.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103003-266
Supplier: Anaspec Inc
Image Unavailable-RLMB-204-0500

Diamond DNA Ladder 250 to 10 Kbp, Rockland Immunochemicals

Description: Diamond DNA Ladder 250-10Kbp
Catalog Number: RLMB-204-0500
Supplier: Rockland Immunochemical
Image Unavailable-RLMB-206-0500

Diamond DNA Ladder 50 to 150 bp, Rockland Immunochemicals

Description: Diamond DNA Ladder 50-150bp
Catalog Number: RLMB-206-0500
Supplier: Rockland Immunochemical
Image Unavailable-RLMB-203-0500

Diamond DNA Ladder 100 to 3000 bp, Rockland Immunochemicals

Description: Diamond DNA Ladder 100-3000bp
Catalog Number: RLMB-203-0500
Supplier: Rockland Immunochemical
Image Unavailable-10014-496

AMPIGENE® DNA Ladder 50 to 1500 bp, Enzo Life Sciences

Description: Ready to use DNA standards for quantifying PCR yield
Catalog Number: 10014-496
Supplier: Enzo Life Sciences

SDS


273 - 288 of 377,029