You Searched For: Molecular+Bioproducts+Inc.

Catalog Number: (76303-874)

Supplier: PeproTech, Inc.

Description: Proteases (also called Proteolytic Enzymes, Peptidases, or Proteinases) are enzymes that hydrolyze the amide bonds within proteins or peptides. Most proteases act in a specific manner, hydrolyzing bonds at, or adjacent to, specific residues or a specific sequence of residues contained within the substrate protein or peptide. Proteases play an important role in most diseases and biological processes including prenatal and postnatal development, reproduction, signal transduction, the immune response, various autoimmune and degenerative diseases, and cancer. They are also an important research tool, frequently used in the analysis and production of proteins. Carboxypeptidase-B sequentially cleaves C-terminal K and R residues. Recombinant Rat Carboxypeptidase-B is a 35.1 kDa protein consisting of 307 amino acids.

Sale

Catalog Number: (102996-266)

Supplier: Anaspec Inc

Description: PACAP-27, the N-terminal fragment of PACAP-38, is a neuropeptide originally isolated from bovine hypothalamus, but is also found in humans and rats. It shows considerable homology with Vasoactive Intestinal Polypeptide (VIP), but stimulates adenylate cyclase much more potently than VIP. PACAP27 and PACAP38 stimulate cAMP accumulation and increase [Ca2+]i through the type I PACAP receptors.
Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
MW: 3147.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Sale

Catalog Number: (103007-668)

Supplier: Anaspec Inc

Description: This Histone 4 peptide is acetylated at lysine 16. Lysine 16 of H4 appears to be a unique target for acetylation. Studies in yeast clearly indicate that acetylation of H4 lysine 16 is an independent specific function in relation to gene transcription when compared to other histone acetylation sites. It was also observed that a human histone acetyltransferase complex showed strong specificity for H4K16 in chromatin and, RNAi-mediated knockdown experiments revealed that it is responsible for the majority of H4 acetylation at lysine 16 in the cell.
Sequence:SGRGKGGKGLGKGGA-K(Ac)-RHRK
MW:2034.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103007-154)

Supplier: Anaspec Inc

Description: This RGD-containing sequence is integrin-binding site. RGD peptides are found in both extracellular matrix (ECM) (e.g., collagen, osteopontin, fibronectin, and vitronectin) and non-ECM proteins (e.g., disintegrins). RGD-containing peptides are recognized by several integrins. This peptide targets both alphavbeta3 and alpha5beta1 integrins. Interaction of the RGDN sequence with endothelial alpha5beta1 integrin causes endothelin-mediated arteriolar vasoconstriction. This peptide influences the IkappaB kinase (IKK)/nuclear factor-kappaB (NF-kappaB) activation. It also controls the cardiac contractile function.
Sequence:GRGDNP
MW:614.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Anaspec Inc

Description: Dynorphins are a class of opioid peptides that arise from the precursor protein prodynorphin. Upon cleavage by proprotein convertase 2 (PC2), multiple active peptides are released: dynorphin A, dynorphin B, and α/β-neo-endorphin. Dynorphins exert their effects primarily through the κ-opioid receptor (KOR), a G-protein-coupled receptor. Dynorphin has been shown to be a modulator of pain response, involved in drug addiction and appetite control.
Sequence:YGGFLRRIRPKLKWDNQ
MW:2147.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103006-416)

Supplier: Anaspec Inc

Description: This is a biotinylated HIV-derived cell penetrating TAT peptide . This positively charged biotin-peptide has been used in studies to form a colloidal coat over oligonucleotides-saturated nanoparticles such that TAT-coated nanoparticles when loaded with dense SiRNA molecules could efficiently penetrate a wide variety of human embryonic stem cells.
Sequence: Biotin-YGRKKRRQRRR
MW: 1786.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Sale

Supplier: Ward's Science

Description: CAS Number: 127-09-3
Formula: NaC2H3O2
Density: 1.53 g/mL
Freezing Point: 324°C
Solubility: Water and Alcohol
Synonyms: Acetic Acid Sodium Salt
Shelf Life: 12 Months

SDS

Supplier: New England Biolabs (NEB)

Description: A number of proprietary plasmids are digested to completion with appropriate restriction enzymes to yield 17 bands suitable for use as molecular weight standards for agarose and polyacrylamide gel electrophoresis

Supplier: New England Biolabs (NEB)

Description: The HindIII digest of lambda DNA (cI857ind1 Sam 7) yields 8 fragments suitable for use as molecular weight standards for agarose gel electrophoresis

Supplier: PeproTech, Inc.

Description: Noggin belongs to a group of diffusible proteins that bind to ligands of the TGF-β family, and regulate their activity by inhibiting their access to signaling receptors. The interplay between TGF-β ligands and their natural antagonists has major biological significance during development processes, in which cellular response can vary considerably depending upon the local concentration of the signaling molecule. Noggin was originally identified as a BMP-4 antagonist whose action was critical for proper formation of the head and other dorsal structures. Consequently, noggin has been shown to modulate the activities of other BMPs including BMP-2,-7,-13, and -14. Targeted deletion of Noggin in mice results in prenatal death, and a recessive phenotype displaying a severely malformed skeletal system. Conversely, transgenic mice over-expressing noggin in mature osteoblasts display impaired osteoblastic differentiation, reduced bone formation, and severe osteoporosis. Recombinant Human Noggin is a 46 kDa disulfide-linked homodimer consisting of two 205 amino acid polypeptide chains. Monomeric glycosylated noggin migrates at an apparent molecular weight of approximately 28.0-33.0 kDa by SDS PAGE analysis under reducing conditions.

Certificates

Supplier: Thermo Fisher Scientific

Description: These high-quality pipette tips are specifically designed to fit Finnpipette® pipettors, but are also compatible with most pipettor brands.

Catalog Number: (470163-148)

Supplier: Wards

Description: This model shows 21 different types of bacteria and bacterial organization.

Sale

Catalog Number: (101418-106)

Supplier: New England Biolabs (NEB)

Description: The microRNA Marker is a set of three synthetic single-stranded RNA oligonucleotides 17, 21 and 25 residues long that have free 5´ ends (i.e., no 5´ phosphate groups)

Sale

Supplier: Ward's Science

Description: CAS Number: 7487-88-9
Formula Weight: 120.37
Formula: MgSO₄
Hazard Info: Irritant
Density (g/mL): 2.7
Solubility: Water and Glycerin
Shelf Life (months): 12
Storage: Green

SDS

Supplier: VWR

Description: Ribonuclease A is an endoribonuclease that efficiently hydrolyzes RNA contaminants in DNA preparations from tissue or bacterial cell cultures. RNase A is used for a variety of molecular biology applications, most commonly for the hydrolysis of RNA that contaminates DNA preparations. This enzyme is used during plasmid purification without nicking or degrading plasmid.

SDS Certificates

Supplier: Agilent Technologies

Description: Markers, 1bp + 6000bp, 3.2mL. 1 bp lower marker; 6,000 bp upper marker. For use with the Fragment Analyzer systems and the DNF-910CP kit.