You Searched For: Molecular+Bioproducts+Inc.


249,603  results were found

SearchResultCount:"249603"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (103007-132)
Supplier: Anaspec Inc
Description: This synthetic peptide corresponds to amino acids 20 to 42 of b-Amyloid protein.
Sequence: FAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 2217.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (103003-174)
Supplier: Anaspec Inc
Description: Fluorescent (TAMRA)-labeled ß-Amyloid peptides. Abs/Em=544/572 nm.
Sequence: TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4742.4 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (470148-986)
Supplier: VWR International
Description: Replicate a Water Molecule


Catalog Number: (470014-262)
Supplier: VWR International
Description: Sized so an entire classroom can see them, these giant molecular models are made from durable polyethylene.


Catalog Number: (103003-254)
Supplier: Anaspec Inc
Description: This is a the tandem repeat sequence of the MUC1 mucin core. MUC1 is a high molecular weight glycoprotein over-expressed by adenocarcinomas, and by different types of bladder tumors. It is also expressed by normal human epithelial cells.
Sequence:APDTRPAPG
MW:1484.6 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (470151-960)
Supplier: VWR International
Description: Create Eight VSEPR Shapes


Catalog Number: (470014-292)
Supplier: VWR International
Description: Useful for individual or group study of molecules, these model sets offer an interactive learning opportunity.


Catalog Number: (103010-882)
Supplier: Anaspec Inc
Description: HiLyte™ Fluor 488 C2 maleimide is an excellent thiol-reactive fluorescent labeling dye that generates the protein conjugates far superior to those of fluorescein derivatives such as FITC.


Catalog Number: (470149-022)
Supplier: VWR International
Description: Enhance Instructor-Led Biochemistry Lessons


Catalog Number: (103007-122)
Supplier: Anaspec Inc
Description: This is the hydrophobic C-terminal fragment of b-Amyloid peptide amino acids 22 to 42.
Sequence: EDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 1999.4 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (103007-362)
Supplier: Anaspec Inc
Description: This peptide amino acids 1 to 17 is a modified fragment of the b-amyloid peptide, with cysteine substituted for valine at position 17.
Sequence: DAEFRHDSGYEVHHQKLC
Molecular Weight: 2171.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (76481-818)
Supplier: AAT BIOQUEST INC
Description: DABCYL is one of the most commonly used dark quenchers for labeling oligos and peptides.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Catalog Number: (103006-672)
Supplier: Anaspec Inc
Description: This is a scrambled sequence of LL-37 used in control experiments.
Sequence: GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
MW: 4493.3 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C


Catalog Number: (103007-790)
Supplier: Anaspec Inc
Description: This peptide is a substrate for p70 ribosomal S6 kinase.
Sequence:KKRNRTLTV
MW:1115.4 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103011-166)
Supplier: Anaspec Inc
Description: Emission-ratiometric fluorescent indicator for quantifying intracellular Ca2+ concentration.


Catalog Number: (103011-408)
Supplier: Anaspec Inc
Description: HiLyte™ Fluor 532 dyes are new members of our proprietary HiLyte™ Fluor series with fluorescence excitation and emission maxima of ~545 nm and ~565 nm, respectively.


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
241 - 256 of 249,603
no targeter for Bottom