You Searched For: Molecular+Bioproducts+Inc.


249,603  results were found

SearchResultCount:"249603"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (10836-724)
Supplier: VWR
Description: VividPro Plus™ is a fluorescent protein stain that can be used in a fast co-electrophoretic protocol to visualize proteins in SDS PAGE gels.

Supplier: VWR
Description: Provides a safe, non-mutagenic alternative to ethidium bromide for instantaneous fluorescent DNA band visualization.
Supplier: Thermo Scientific Chemicals
Description: 1/8in Pellets
Catalog Number: (470129-050)
Supplier: BRIGHT OF SWEDEN
Description: Magnetic Manipulation of Atoms and Molecules.


Supplier: Ward's Science
Description: CAS Number: 7647-14-5
Formula: NaCl
Density: 2.16 g/mL
Boiling and Freezing Point: 1465°C, 801°C
Shelf Life: 36 Months

SDS

Catalog Number: (101228-466)
Supplier: New England Biolabs (NEB)
Description: The BstNI Digest of pBR322 DNA yields 6 fragments suitable for use as molecular weight standards for agarose gel electrophoresis

Small Business Enterprise


Catalog Number: (102996-094)
Supplier: Anaspec Inc
Description: Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
MW: 4117.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Supplier: New England Biolabs (NEB)
Description: Quick-Load Purple 2-Log DNA Ladder is a pre-mixed, ready-to-load molecular weight marker containing one tracking dye
Catalog Number: (470353-966)
Supplier: MARCUS SOMMER
Description: Somso® premium quality models.


Catalog Number: (PAD1531)
Supplier: Promega Corporation
Description: phiX174 replicative form (RF) is a double-stranded circular DNA molecule of 5,386 bases. Used in assays of restriction enzymes for the presence of nickase activity.

Catalog Number: (103007-960)
Supplier: Anaspec Inc
Description: This is a biotin labeled H3K9(Ac) Histone. H3K9(Ac) is highly localized to the 5’ region of transcription start sites in human genes. Localization of H3K9(Ac)  to the transcriptionally active 5’ region of human genes suggests this peptide is essential for transcription initiation and elongation.
Sequence:ARTKQTAR-K(Ac)-STGGKAPRKQLA-GGK(Biotin)-NH2
MW:2764.3 Da
% peak area by HPLC:95
Storage condition:-20° C


Supplier: VWR
Description: TAE is an extensively used buffer for agarose gel electrophoresis applications requiring high resolution and separation of high molecular weight, double-stranded DNA
Supplier: ACROBIOSYSTEMS
Description: Human IL-17 RA & IL-17 RC Heterodimer Protein, Fc Tag&Fc Tag, Source: expressed from HEK293, Predicted N-terminus: Leu 33 (IL-17RA) & Leu 21 (IL-17RC), Molecular weight: 60.0 kDa (IL-17RA) & 75.7 kDa (IL-17RC), Synonyms: IL-17 RA & IL-17 RC, IL-17RA & IL-17RC, CD217 & IL-17 RC, Size: 100uG

Supplier: PeproTech, Inc.
Description: Cluster of differentiation 8 (CD8), a type I transmembrane glycoprotein of the immunoglobulin family of receptors, plays an integral role in signal transduction, and T cell differentiation and activation. CD8 is predominantly expressed on T cells as a disulfide-linked heterodimer of CD8alpha and CD8beta, where it functions as a co-receptor, along with T cell receptor (TCR), for major histocompatibilty complex class I (MHC-I) molecules; whereas its counterpart, CD4, acts as a co-receptor for MHC-II molecules. CD8 exists on the cell surface, where the CD8alpha chain is essential for binding to MHC-I. CD8 is also expressed on a subset of T cells, NK cells, monocytes and dendritic cells as disulfide-linked homodimers of CD8alpha. Ligation of MHC-I/peptide complexes presented by antigen-presenting cells (APCs), triggers the recruitment of lymphocyte-specific protein tyrosine kinase (Lck), which leads to lymphokine production, motility and cytotoxic T lymphocyte (CTL) activation. Once activated, CTLs play a crucial role in the clearance of pathogens and tumor cells. Differentiation of naive CD8+ T cells into CTLs is strongly enhanced by IL-2, IL-12 and TGF-beta1. PeproTech's CHO cell-derived Recombinant Human sCD8alpha is a monomeric glycoprotein of 161 amino acid residues, which corresponds to the extracellular domain of CD8alpha. Peprotech's CHO cell-derived Recombinant Human sCD8alpha has a calculated molecular weight of 17.6 kDa; however, due to glycosylation, it migrates at an apparent molecular weight of approximately 27-29 kDa by SDS-PAGE analysis, under reducing conditions.

Catalog Number: (470129-048)
Supplier: BRIGHT OF SWEDEN
Description: Intuitive and Hands-On Teaching Tool.


Supplier: GE Healthcare - Life Sciences
Description: For determination of molecular weight of uncharacterised protein samples with precision by comparison with carefully selected standards.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,497 - 2,512 of 249,603
no targeter for Bottom