Print…

You Searched For: Molecular+Bioproducts+Inc.


249,603  results were found

Refine Results Sort by
SearchResultCount:"249603"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-103007-274

Noxa BH3, Peptide 1

Catalog Number: (103007-274)
Supplier: Anaspec Inc
Description: This peptide belongs to the Bcl-2 family of proteins. Noxa gene encodes a Bcl-2 homology 3 (BH3)-only member of this family; it contains the BH3 region, not other BH domains. When ectopically expressed, Noxa undergoes BH3 motif-dependent localization to mitochondria, it interacts with anti-apoptotic Bcl-2 family members resulting in the activation of caspase-9.
Sequence:PAELEVECATQLRRFGDKLNFRQKLL
MW:3075.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-102996-554

Human;Rat [Leu31, Pro34]-Neuropeptide Y

Catalog Number: (102996-554)
Supplier: Anaspec Inc
Description: Like neuropeptide Y (NPY) and other peptides of the family, this peptide adopts a folded hairpin structure with the terminal segments in close proximity. An intracerebroventricular injection of NPY or [Leu31, Pro34]-NPY (non-Y2 receptor agonist) given during middle cerebral artery occlusion increases the infarct volume and nitric oxide (NO) overproduction in the rat brain.
Sequence:YPSKPDNPGEDAPAEDMARYYSALRHYINLLTRPRY-NH2
MW:4240.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103006-658

Rabies virus Rabies Virus Glycoprotein

Catalog Number: (103006-658)
Supplier: Anaspec Inc
Description: This peptide is a 29 amino acid fragment derived from rabies virus glycoprotein (RVG). Because neurotropic viruses cross the blood-brain barrier to infect brain cells, the same strategy may be used to enter the central nervous system and deliver siRNA to the brain. This peptide specifically binds to the acetylcholine receptor expressed by neuronal cells.
Sequence:YTIWMPENPRPGTPCDIFTNSRGKRASNG
MW:3266.7 Da
% peak area by HPLC:95
Storage condition:-20° C
Product Image-470225-780

Magnesium Bromide Hexahydrate

Catalog Number: (470225-780)
Supplier: Ward's Science
Description: CAS Number: 13446-53-2
Formula Weight: 292.25
Formula: MgBr2·6H2O
Synonyms: Magnesium Bromide 6-Hydrate
Shelf Life (months): 12
Storage: Green

SDS


Image Unavailable-103008-246

Human Amylin Acetate

Catalog Number: (103008-246)
Supplier: Anaspec Inc
Description: Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. For Research Use Only.
Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt
MW: 3949.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Image Unavailable-102996-266

Human;Sheep;Rat PACAP (1-27), amide

Catalog Number: (102996-266)
Supplier: Anaspec Inc
Description: PACAP-27, the N-terminal fragment of PACAP-38, is a neuropeptide originally isolated from bovine hypothalamus, but is also found in humans and rats. It shows considerable homology with Vasoactive Intestinal Polypeptide (VIP), but stimulates adenylate cyclase much more potently than VIP. PACAP27 and PACAP38 stimulate cAMP accumulation and increase [Ca2+]i through the type I PACAP receptors.
Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
MW: 3147.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Product Image-470301-360

Lead(II) Nitrate

Supplier: Ward's Science
Description: CAS Number: 10099-74-8
Formula: PbNO32
Density: 4.53 g/mL
Solubility: Water and Alcohol
Synonyms: Lead Dinitrate
Shelf Life: 36 Months

SDS

Image Unavailable-102996-526

Dynorphin A (1-17)

Supplier: Anaspec Inc
Description: Dynorphins are a class of opioid peptides that arise from the precursor protein prodynorphin. Upon cleavage by proprotein convertase 2 (PC2), multiple active peptides are released: dynorphin A, dynorphin B, and α/β-neo-endorphin. Dynorphins exert their effects primarily through the κ-opioid receptor (KOR), a G-protein-coupled receptor. Dynorphin has been shown to be a modulator of pain response, involved in drug addiction and appetite control.
Sequence:YGGFLRRIRPKLKWDNQ
MW:2147.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Image Unavailable-103006-416

HIV TAT (47-57) Biotin Peptide, Biotin

Catalog Number: (103006-416)
Supplier: Anaspec Inc
Description: This is a biotinylated HIV-derived cell penetrating TAT peptide . This positively charged biotin-peptide has been used in studies to form a colloidal coat over oligonucleotides-saturated nanoparticles such that TAT-coated nanoparticles when loaded with dense SiRNA molecules could efficiently penetrate a wide variety of human embryonic stem cells.
Sequence: Biotin-YGRKKRRQRRR
MW: 1786.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-103007-840

Srctide, FAM (Carboxyfluorescein)

Catalog Number: (103007-840)
Supplier: Anaspec Inc
Description: This peptide is Srctide with an N-terminal 5-FAM (Ex/Em=494/521 nm) label. Srctide is a substrate for many protein kinases, such as Blk, BTK, cKit, EPHA1, EPHB2, EPHB3, ERBB4, FAK, Flt3, IGF-1R, ITK, Lck, MET, MUSK, Ret, Src, TIE2, TrkB, VEGF-R1 (Flt-1) and VEGF-R2 (KDR).
Sequence:5-FAM-GEEPLYWSFPAKKK-NH2
MW:2037.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103006-564

Sheep SMAP 29 Peptide

Catalog Number: (103006-564)
Supplier: Anaspec Inc
Description: This 29 amino acid sheep myeloid antimicrobial peptide 29 (SMAP 29) displays extremely high antimicrobial activity against Pseudomonas strains, other gram-negative bacteria, and multidrug-resistant pathogens. SMAP 29 is a broad-spectrum antibiotic cathelicidin, it is active in both low- and high-ionic-strength conditions, and induces significant morphological alterations in bacterial surfaces.
Sequence:RGLRRLGRKIAHGVKKYGPTVLRIIRIAG
MW:3256 Da
% peak area by HPLC:95
Storage condition:-20° C
Product Image-97065-002

VWR® Blue Bandit™ Protein Stain Ultra Pure Grade

Catalog Number: (97065-002)
Supplier: VWR
Description: Blue BANDit™ is a safer and more environmentally friendly alternative to traditional Coomassie® Blue staining procedures.

SDS Certificates


Product Image-101228-502

PCR Marker, New England Biolabs

Supplier: New England Biolabs (NEB)
Description: The PCR Marker consists of a proprietary plasmid that is digested to completion with appropriate restriction enzymes to yield 5 double-stranded DNA bands suitable for use as molecular weight standards for agarose and acrylamide gel electrophoresis

Small Business Enterprise

Image Unavailable-102996-508

Conus geographus Conantokin G

Catalog Number: (102996-508)
Supplier: Anaspec Inc
Description: Conantokin G (Con G) toxin is a 17-amino-acid competitive antagonist of N-methyl-D-aspartate (NMDA) receptors. It was isolated from the venom of Conus geographus and it belongs to a unique family of g-carboxyglutamic acid-containing Conus peptides.
Sequence:GE(Gla)(Gla)LQ(Gla)NQ(Gla)LIR(Gla)KSN-NH2
MW:2264.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Product Image-470340-208

Molecular Model Set, Teacher

Catalog Number: (470340-208)
Supplier: United Scientific Supplies
Description: Suitable for constructing complex organic and inorganic molecules.
Product Image-470320-056

Minit® Atoms, Bonds and Accessories

Supplier: Cochranes of Oxford
Description: Order extra atoms, bonds, and accessories to supplement your Minit® Sets.

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,481 - 2,496 of 249,603
no targeter for Bottom