You Searched For: PERKINELMER U.S. LLC

Description: Crystals. For LC and molecular biology. Lot analysis on label.

Catalog Number: JT4008-5

Supplier: AVANTOR PERFORMANCE MATERIAL LLC

SDS Certificates Sale

Description: What is the resulting balanced equation?

Catalog Number: 470232-060

Supplier: Mega Molecules

Sale

Description: This is amino acids 1 to 7 fragment of the histone H4. Alterations in chromatin structure, such as nucleosome sliding, removal of nucleosomes, and disruption of DNA–histone or histone–histone contacts through post-translational modification of the histones, have been linked to transcriptional regulation, DNA damage repair, and replication, among other cellular processes. Modification of histones occurs primarily in the N-terminal residues or tail region. These modifications include phosphorylation, ubiquitinylation, methylation, sumolyation, and acetylation. Lys5 may serve as the acetylation site for this peptide.
Sequence:SGRGKGG
MW:617.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-508

Supplier: Anaspec Inc

Sale

Description: The R-Spondin (Rspo) proteins belong to the Rspo family of Wnt modulators. Currently, the family consists of four structurally-related, secreted ligands (Rspo 1-4), all containing furin-like and thrombospondin structural domains. The Rspo proteins can interact with the Frizzled/LRP6 receptor complex in a manner that causes the stabilization, and resulting accumulation, of the intracellular signaling protein, β-catenin. This activity effectively activates and increases the subsequent nuclear signaling of β-catenin. R-Spondin can also bind to the previously discovered G-protein coupled receptors, LGR-4 and LGR-5. Rspo/β-catenin signaling can act as an inducer of the transformed phenotype, and can also regulate the proliferation and differentiation of certain stem cell populations. Recombinant Human R-Spondin-2 is a 24.4 kDa protein consisting of 212 amino acid residues. Due to glycosylation, R-Spondin-2 migrates at an apparent molecular weight of approximately 30.0 kDa by SDS PAGE analysis under reducing conditions.

Catalog Number: 10779-262

Supplier: PeproTech, Inc.

Sale

Description: This peptide is a 1 to 20 amino acid fragment of the interphotoreceptor retinoid binding protein (IRBP). IRBP is a 140-kDa glycolipoprotein residing in the interphotoreceptor matrix between the neural retina and the retinal pigment epithelium. Human IRBP peptide 1-20 contains a major epitope for the H-2b haplotype. Immunization with IRBP (1 – 20) induces T-cell–mediated experimental autoimmune uveoretinitis (EAU) disease. The pathology of disease induced by the peptide, or by adoptive transfer of cells specific to the peptide, is similar to that induced by the whole IRBP protein.
Sequence:GPTHLFQPSLVLDMAKVLLD
MW:2194.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-278

Supplier: Anaspec Inc

Sale

Description: The IL-2 receptor system consists of three non-covalently linked subunits termed IL-2Ralpha, IL-2Rbeta, and IL-2Rgamma. The IL-2Ralpha is a type I transmembrane protein consisting of a 219 amino acid extracellular domain, a 19 amino acid transmembrane domain and a 13 amino acid intracellular domain, which is not involved in the transduction of IL-2 signals. Proteolytic processing of IL-2Ralpha releases the entire extracellular domain of IL-2Ralpha, thereby generating a 219 amino acid soluble protein called soluble IL-2Ralpha (sIL-2Ralpha). The homodimeric form binds IL-2 (KD=10mM) and facilitates IL-2 signaling. The secreted sIL-2Ralpha is expressed on leukemia cells, lymphoma cells, and newly activated T and B cells, as well as on approximately 10% of NK cells. Recombinant Human sIL-2 Receptor alpha is a 24.8 kDa protein containing 219 amino acid residues consisting of only the extracellular domain of IL-2Ralpha. As a result of glycosylation, Recombinant Human sIL-2 Receptor alpha migrates with an apparent molecular mass of approximately 40-50 kDa by SDS-PAGE gel, under reducing and non-reducing conditions.

Catalog Number: 76303-782

Supplier: PeproTech, Inc.

Sale

Description: The R-Spondin (Rspo) proteins belong to the Rspo family of Wnt modulators. Currently, the family consists of four structurally-related, secreted ligands (Rspo 1-4), all containing furin-like and thrombospondin structural domains. The Rspo proteins can interact with the Frizzled/LRP6 receptor complex in a manner that causes the stabilization, and resulting accumulation, of the intracellular signaling protein, β-catenin. This activity effectively activates and increases the subsequent nuclear signaling of β-catenin. R-Spondin can also bind to the previously discovered G-protein coupled receptors, LGR-4 and LGR-5. Rspo/β-catenin signaling can act as an inducer of the transformed phenotype, and can also regulate the proliferation and differentiation of certain stem cell populations. Recombinant Human R-Spondin-3 is a 26.9 kDa protein consisting of 240 amino acid residues. Due to glycosylation, R-Spondin-3 migrates at an apparent molecular weight of approximately 37.0 kDa by SDS PAGE analysis under reducing conditions.

Catalog Number: 10779-280

Supplier: PeproTech, Inc.

Sale

Description: ß-Secretase (BACE1) is a key enzyme involved in the production of Aß peptides found in extracellular amyloid plaques of Alzheimer’s disease (AD). The enzyme has been implicated as an excellent target for anti-amyloid therapy of AD. This statine-based substrate analog, beta-secretase inhibitor P10–P4’ statV, is used in the inhibition of beta-secretase activity from homogenized wild-type mouse cortices and from BACE-purified from human brain.
Sequence:KTEEISEVN-Sta-VAEF (Sta = statine)
MW:1651.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 102999-752

Supplier: Anaspec Inc

Sale

Description: VividPro Plus™ is a fluorescent protein stain that can be used in a fast co-electrophoretic protocol to visualize proteins in SDS PAGE gels.

Catalog Number: 10836-724

Supplier: VWR

SDS Certificates Sale

Description: CAS Number: 64-19-7
Formula: CH3COOH
Density: 1.049 g/ml
Boiling Point: 118.1°C
Freezing Point: 16.7°C

Catalog Number: 470225-820

Supplier: Ward's Science

SDS Sale

Description: Osteocalcin (OC) is a 49 amino acid peptide found exclusively in bone tissue and is highly conserved among species. It is a vitamin K- and D-dependent protein produced by osteoblasts, osteocytes and odontoblasts. It is deposited in extracellular bone matrix and is found in the serum. Serum osteocalcin, hydrolysed in the kidney and liver, is considered a specific marker of osteoblast activity and bone formation rate. It may be involved in regulation of osteoblast function, regulation of bone turnover and/or mineralization.
Sequence: YLYQWLGAPVPYPDPL-Gla-PRR-Gla-VC-Gla-LNPDCDELADHIGFQEAYRRFYGPV (Gla=γ-Carboxyglutamic Acid; Disulfide bridge: 23-29)
MW: 5929.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: 102999-356

Supplier: Anaspec Inc

Sale

Description: Learn How to Make a Conductivity Indicator

Catalog Number: 470105-836

Supplier: VWR

Sale

Description: The sequence of this synthetic peptide is based on the primary site of cleavage by plasmepsin II (PM II) within hemoglobin (Hb), and numbering of the peptide corresponds to the residue within the a-chain of Hb. Plasmepsins are involved in the early steps of hemoglobin degradation. They are able to recognize intact hemoglobin and make an initial cleavage in the B helix of the hemoglobin a-chain between Phe-33 and Leu-34.
Sequence:EDANS-CO-CH2-CH2-CO-ALERMFLSFP-Dap(DABCYL)OH
MW:1896 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-156

Supplier: Anaspec Inc

Sale

Description: This 32 amino acid peptide contains a 17 amino acid ring structure that is common to all natriuretic peptides. It is also called the brain natriuretic peptide (BNP) because it was first identified in porcine brain; however, the main source of this peptide is not the brain but the cardiac ventricle. This cardiac neurohormone is secreted from the ventricles in response to volume expansion and pressure overload. It has natriuretic and vasodilatory effects and suppresses the renin-angiotensin-aldosterone system.
Sequence:SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
MW:3464.1 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: 102996-424

Supplier: Anaspec Inc

Sale

Description: This is a 20–amino acid Bax BH3 peptide (Bax 1) capable of inducing apoptosis in a variety of cell line models. In addition to disrupting Bax/Bcl-2 and Bax/Bcl-XL, it can promote cytochrome c release from isolated mitochondria. Bax BH3 belongs to the Bcl-2 protein family which consists of both pro-apoptotic and anti-apoptotic members. Bax BH3 acts to regulate apoptosis via governance of the 'intrinsic' pathway of cell death.
Sequence:STKKLSECLKRIGDELDSNM
MW:2267.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-264

Supplier: Anaspec Inc

Sale

Description: This peptide is histone H3 (1-30) acetylated at Lys14, Lys18, Lys23 and Lys27, with a C-terminal GG linker followed by a biotinylated Lys. Hyperacetylation of histone H3 plays a role in chromatin structure and transcriptional activation. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARKSTGG-K(Ac)-APR-K(Ac)-QLAT-K(Ac)-AAR-K(Ac)-SAP-GGK(Biotin)
MW:3802.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103009-090

Supplier: Anaspec Inc

Sale