You Searched For: sander


613,157  results were found

SearchResultCount:"613157"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (102999-768)
Supplier: Anaspec Inc
Description: Biotin - Bradykinin, Sequence: Biotin - RPPGFSPFR, Purity: HPLC greater than or equal to 95%, Molecular Weight: 1286.5, Apperance: Lyophilized white powder, Peptide Reconstitution: Biotin-Bradykinin is freely soluble in water, Storage: -20 deg C, Size: 1 mg


Catalog Number: (103003-006)
Supplier: Anaspec Inc
Description: Src Optimal Peptide Substrate, Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 1799, Sequence: AEEEIYGEFEAKKKK, Identified as a Src optimal peptide substrate, used to measure the wild type Src activity, Storage: At -20 degree C, Size: 1mg


Catalog Number: (103254-922)
Supplier: ADVANSTA INC MS
Description: Kit, Real-Time, Visible, In-gel Protein Stain, sample-loading buffer and protein stain, in one, Instant and sensitive results. Detects as little as 10 to 25 ng per band, Flexible use with reducing and non-reducing gels, compatible with downstream mass spectrometry, for 10 gels, Size: 300ul


Catalog Number: (103254-924)
Supplier: ADVANSTA INC MS
Description: Kit, Real-Time, Visible, In-gel Protein Stain, sample-loading buffer and protein stain, in one, Instant and sensitive results. Detects as little as 10 to 25 ng per band, Flexible use with reducing and non-reducing gels, compatible with downstream mass spectrometry, for 100 gels, Size: 3ml


Catalog Number: (103003-184)
Supplier: Anaspec Inc
Description: [Glu1]-Fibrinopeptide B, Purity: HPLC >/- 95%, Molecular Weight: 1570.6, Sequence: H-Glu-Gly-Val-Asn-Asp-Asn-Glu-Glu-Gly-Phe-Phe-Ser-Ala-Arg-OH, Appearance: Lyophilized white powder, This peptide is derived from fibrinopeptide B amino acid residues 1-14, Size: 1 mg


Catalog Number: (103011-346)
Supplier: Anaspec Inc
Description: Dihydroethidium, Synonym: Hydroethidine, 5 mM solution in DMSO, Bind to DNA/RNA (red fluorescence) upon oxidation, Molecular Weight: 315.4, Spectral Properties Abs/Em = 518/605 nm (after oxidation), CAS number: 104821-25-2, Molecular Formula: C21H21N3, Storage: -20C, Size: 1 ml


Catalog Number: (103011-006)
Supplier: Anaspec Inc
Description: Tetramethylrhodamine - 5 C2 maleimide, alternative to tetramethylrhodamine-5-maleimide, with spectral characteristics, Molecular Weight: 552.58, Molecular Formula: C31H28N4O6, Spectral Properties: Abs/Em = 544/572nm, Solvent System: DMF or DMSO, Size: 5 mg


Catalog Number: (103374-202)
Supplier: Biosynth International Inc
Description: Isomalt, Purity: 97.0% HPLC, CAS Number: 64519-82-0, Molecular Formula: C12H24O11, Molecular weight: 344.31 g/mol, Synonyms: 6-O-alpha-D-Glucopyranosyl-D-glucitol mixed with 1-O-alpha-D-glucopyranosyl-D-mannitol; C-Isomaltidex; Palatinit; Palatinitol, Storage: -15 deg C, size: 5KG

SDS


Catalog Number: (103374-198)
Supplier: Biosynth International Inc
Description: Isomalt, Purity: 97.0% HPLC, CAS Number: 64519-82-0, Molecular Formula: C12H24O11, Molecular weight: 344.31 g/mol, Synonyms: 6-O-alpha-D-Glucopyranosyl-D-glucitol mixed with 1-O-alpha-D-glucopyranosyl-D-mannitol; C-Isomaltidex; Palatinit; Palatinitol, Storage: -15 deg C, size: 1KG

SDS


Catalog Number: (103374-204)
Supplier: Biosynth International Inc
Description: Isomalt, Purity: 97.0% HPLC, CAS Number: 64519-82-0, Molecular Formula: C12H24O11, Molecular weight: 344.31 g/mol, Synonyms: 6-O-alpha-D-Glucopyranosyl-D-glucitol mixed with 1-O-alpha-D-glucopyranosyl-D-mannitol; C-Isomaltidex; Palatinit; Palatinitol, Storage: -15 deg C, size: 10KG

SDS


Catalog Number: (103374-200)
Supplier: Biosynth International Inc
Description: Isomalt, Purity: 97.0% HPLC, CAS Number: 64519-82-0, Molecular Formula: C12H24O11, Molecular weight: 344.31 g/mol, Synonyms: 6-O-alpha-D-Glucopyranosyl-D-glucitol mixed with 1-O-alpha-D-glucopyranosyl-D-mannitol; C-Isomaltidex; Palatinit; Palatinitol, Storage: -15 deg C, size: 2.5KG

SDS


Catalog Number: (BDH3042-2.5LP)
Supplier: BDH
Description: VWR* Hydrofluoric Acid, 48%, ACS Grade, Molecular formula: HF, Molecular weight: 20.01, CAS: 7664-39-3, density: 1.17kg/L, Size: 2.5L PPQ poly bottle.

Catalog Number: (103006-240)
Supplier: Anaspec Inc
Description: Histatin - 5, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): DSHAKRHHGYKRKFHEKHHSHRGY, Molecular Weight: 3036.3, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg


Catalog Number: (103007-600)
Supplier: Anaspec Inc
Description: [Asn7]-beta-Amyloid (1-40), Tottori-Japanese Mutation, Sequence: DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, Purity: By HPLC greater than or equal to 95%, Molecular Weight: 4328.9, Apperance: Powder, Storage: -20 deg C, Size: 0.5 mg


Catalog Number: (103003-354)
Supplier: Anaspec Inc
Description: Angiotensin III, Purity: HPLC >/- 95%, Molecular Weight: 931.1, Sequence: H-Arg-Val-Tyr-Ile-His-Pro-Phe-OH, Appearance: Powder, Storage: -20 deg C, Size: 5 mg


Catalog Number: (10774-828)
Supplier: PeproTech, Inc.
Description: Recombinant Human Neuritin, Animal Free, 9.72 kDa polypeptide monomers, each containing 88 amino acid residues, Neuritin acts as a molecular mediator of neurite outgrowth, neuronal survival, Source: E.coli, Cross reactivity: Rat, Purity: >98%, Synonyms: CPG15, NRN1500UG


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,481 - 2,496 of 613,157
no targeter for Bottom